Fc fusion proteins for enhancing the immunogenicity of protein and peptide antigens

专利摘要:
The invention disclosed herein relates to methods and compositions for enhancing the immunogenicity of preselected protein or peptide antigens in mammals. Immunogenicity is enhanced by fusing a preselected antigen to an immunoglobulin heavy chain constant to produce an Fc-antigen fusion protein. Fc-antigen fusion proteins target antigen to antigen presenting cells in mammals by binding to Fc receptors on the surface of antigen presenting cells. Also disclosed are adjuvants, such as Fc-adjuvant fusion proteins, for use with Fc-antigen fusion proteins that enhance or modulate specific immune responses against preselected antigens.
公开号:KR20020020794A
申请号:KR1020027000879
申请日:2000-07-21
公开日:2002-03-15
发明作者:길리어스스테판디；로킨밍；웨솔로우스키존에스쥬니어
申请人:추후보정；렉시겐 파마슈티칼스, 코프.；
IPC主号:

专利说明:

FC FUSION PROTEINS FOR ENHANCING THE IMMUNOGENICITY OF PROTEIN AND PEPTIDE ANTIGENS
[2] The development of conventional vaccines has focused on producing protective antibodies that can neutralize pathogens. To date, agents used as vaccines typically include inactivated or attenuated microorganisms (eg bacteria or viruses), their products (eg toxins) or purified antigens. With the advent of modern molecular biology and gene cloning methodologies, more pure and clearly more specific vaccines can be made. Moreover, knowledge of the immune system at the molecular level has enabled the isolation and characterization of immune responses stimulated by pathogens. Two elements of the immune system that are believed to be central to the successful production of immune responses include the central role of regulatory cytotoxic T cells and the way antigens are produced in these cells by antigen presenting cells (APCs). See, eg, W. E. Paul, ed. (1993) FUNDAMENTALS OF IMMUNOLOGY, Raven Press, Ltd., New York.
[3] Typically, protein antigens or peptide antigens donated from outside of APC (exogenous antigen) are denatured in vesicles or endosomes of endocytosis of APC, and the resulting peptide fragments are combined with major histocompatibility group (MHC) group II proteins. To form a complex. The resulting complex migrates to the cell surface, where the complex appears in immune cells adjacent to APC. The peptide fragment conforms to the groove defined by the MHC molecule, so that the complex can be recognized by T cells expressing a T cell receptor having binding specificity for the complex. The interaction between peptide-loaded MHC group II molecules and helper T cells (referred to in the art as CD4 T cells) is on the surface of T cells by other interactions between the MHC group II molecules themselves and the CD4 ⁺ receptor. Can be further stabilized. Thus, exogenous antigens treated in APC cells appear on the cell surface via MHC group II molecules. The MHC group II complex, when present on CD4 ⁺ T cells, produces CD4 ⁺ helper cell secreting cytokines that stimulate B cells to produce antibodies to peptides. See Paul (homologous).
[4] Vaccination with exogenous antigens generally produces a CD4-cell mediated T cell response from which the antibody is produced. Cytotoxic T cells (CTL) are not normally stimulated by such pathways. CTL is apparently stimulated when the antigen is derived from the interior of the APC itself (endogenous antigen), such as through the production of cancer-specific proteins in cancer cells or viral proteins in viral infected cells. In fact, in many viral diseases, the production of CTL is considered important in that it recovers from infection by removing virally infected cells.
[5] Studies show that endogenous and exogenous antigens are treated differently. During the synthesis of neonatal polypeptides, some of the polypeptides are denatured by extracellular constructs called proteasomes. In fragments derived from this processing complex with the newly synthesized MHC group I but not the MHC group II molecules, the resulting antigens comprising the MHC group I complex are transferred to the cell surface. In addition, T cells specific for a particular peptide fragment bind T cells, but in this case the necessary co-receptor interactions occur between the MHC group I molecules and the CD8 molecules. Thus, endogenous antigen on the surface of APC appears in CD8 ⁺ T cells. Although there are some forms of CD8 ⁺ T cells that are not cytotoxic, CD8 ⁺ T cells form most of the CTL.
[6] Thus, the design of vaccines capable of eliciting strong CTL responses seems to require that antigenic molecules (generally proteins) can be prepared inside cells or delivered to appropriate cell compartments to enter the MHC group I processing pathway. . One strategy is to insert a gene encoding a protein or peptide of interest into a virus and use the treated virus as a vaccine (Lorenz et al. (1999) HUM. GENE THER. 10: 623-631). Another strategy is to inject a cell with a protein-encoding DNA vector and then administer the cell to an animal or patient, wherein the DNA is expressed from within the cell and appears on the cell surface via the MHC group I molecule (Donnelly et al. (1997)). ANNU.REV.IMMUNOL. 15: 617). Simple techniques for injecting DNA vectors directly into muscle or skin appear to induce antibody responses to CTLs and / or several antigens (Lai et al. (1988) CRIT.REV.IMMUNOL. 18: 449-484 and US Pat. 5,589,466). It has been studied that antigens are taken and treated with APC and appear in the immune system (Lai, homology).
[7] Delivery of exogenous peptides or proteins to the MHC group I pathway is more recently achieved through the use of a mixture of squalene and surfactants and chemical adjuvants such as Freund's adjuvant (Hilgers et al. (1999) VACCINE 17: 219-228). Partial success was achieved by using small antigen-coated beads that induced CTL responses through phagocytosis and alternative MHC group I pathways by macrophages (De Bruijin et al. (1995) EUR.J.IMMUNOL. 25: 1274-1285). . Moreover, other methods for enhancing an immune response to an antigen include using chemical adjuvant in combination with recombinant immunostimulatory cytokines such as IL-2, IL-12, GM-CSF, and the like. For example, there is a method of using an anti-hapten antibody fused to IL-2 by linking the cytokine to a protein antigen chemically reacting with hapten (Harvill et al. (1996) J.IMMUNOL. 157: 3165).
[8] Another technique is to develop an antibody "antigenization" whereby a portion of the immunoglobulin variable region is replaced with a peptide antigen. When the recombinant antibody interacts with the Fc receptor on the APC surface and binds to APC, the peptide antigen of the hybrid molecule appears in APC (Lanza et al. (1993) PROC.NATL.ACAD.SCI.USA 90: 11683-11687). To extend this approach, splenic injection of plasmid DNA encoding an "antigenized" immunoglobulin heavy chain is used, followed by spleen-derived B cells secreting recombinant antibodies, provided an immunoglobulin light chain partner.
[9] However, immunogenicity of the antigen delivery system is one of the major technical obstacles in the development of modern vaccines. The purpose of vaccination is to elicit a strong immune response. However, because the host immune system has evolved to fight bacteria and viruses, using bacteria or viruses as vectors will usually destroy the messenger according to the message. Moreover, strong immune responses to certain viral vectors, such as vaccinia and adenovirus, have limited their use and have observed that similar problems arise while using bacterial toxins such as protein vectors. Similarly, antibody-based "protein vectors" (which are not considered "autologous" by the immune system) utilizing the variable regions are potentially immunogenic, depending on their nature. It has been observed that various uses of these carrier molecules can induce anti-idiotypic responses and thus hinder their efficient use. Accordingly, it is an object of the present invention to provide a vaccine that produces strong and lasting immunity against a preselected protein or peptide antigen.
[1] The present invention generally relates to methods and compositions for enhancing the immunogenicity of preselected protein or peptide antigens in mammals. More specifically, the invention relates to a method and composition comprising an amino acid sequence representing a fusion protein containing an immunoglobulin heavy chain constant region and a preselected antigen and a nucleic acid encoding the same, wherein the preselected antigen of the fusion protein is preselected Compared with antigen alone, mammals can elicit stronger immune responses.
[69] The above-mentioned various objects, features and advantages of the present invention as well as the present invention itself will be fully understood from the following preferred embodiments with reference to the accompanying drawings.
[70] 1A-1G are schematic diagrams of exemplary Fc-fusion proteins useful in the practice of the present invention. Figure 1A shows an Fc-antigen or Fc-adjuvant fusion protein, wherein the immunoglobulin heavy chain constant region 1 is attached to the N-terminal end of the antigen or adjuvant 2. Figure 1B shows the Fc-antigen or Fc-adjuvant fusion protein, wherein the immunoglobulin heavy chain constant region (1) is attached to the C-terminal end of the antigen or adjuvant (2). 1C and 1D show dimeric proteins, wherein one or both polypeptide chains comprise an Fc-antigen or Fc-adjuvant fusion protein. In FIG. 1C, an immunoglobulin heavy chain constant region (1) is attached to the N-terminal end of an antigen or adjuvant (2) in one or more polypeptide chains, and FIG. 1D shows that the immunoglobulin heavy chain constant region (1) is an antigen or adjuvant. It is attached to the C-terminal end of the band 2. 1E shows a dimeric protein wherein one or both polypeptide chains comprise an Fc-antigen-antigen, an Fc-adjuvant-adjuvant, an Fc-adjuvant-antigen or an Fc-antigen-adjuvant fusion protein . 1F shows a dimeric fusion protein, wherein one or both polypeptide chains comprise an antigen-Fc-adjuvant or an adjuvant-Fc-antigen fusion protein. 1G shows a dimeric fusion protein, wherein one or both polypeptide chains comprise an antigen-adjuvant-Fc or an adjuvant-antigen-Fc fusion protein.
[71] 2A and 2B are schematic diagrams of DNA sequences useful in the practice of the present invention. 2A shows human Fc fusion protein expression vector. 2B shows gene fusion for expression of mouse IgG 2a Fc fusion protein.
[72] 3A-3F show the effects of chemical and Fc-cytokine adjuvants on antibody production in mice immunized with Fc-antigen fusion protein, mouse Fc-human IL-4 receptor ectoregion (Fc-IL-4R) fusion protein. It is a graph. In FIG. 3A, mice were immunized with Fc-IL-4R and Fc-IL-2 in Freund's complete adjuvant (CFA). In FIG. 3B, mice were immunized with Fc-IL-4R in phosphate buffered saline (PBS). In Figure 3C, mice were immunized with Fc-IL-4R in CFA. In FIG. 3D, mice were immunized with Fc-IL-4R and Fc-IL-2 in PBS. In Figure 3E, immunization with Fc-IL-4R and Fc-GMCSF in CFA. In Figure 3F, mice were immunized with Fc-IL-4R and Fc-GMCSF in PBS. In Figures 3A-3F, square, diamond shaped triangles represent data from three individual mice. Antibody concentrations for antigens were measured by ELISA, and the Y-axis represents the optical density of the ELISA readout.
[73] 4A-4D show the effect of varying the amount of Fc-GMCSF as an adjuvant to immunize mice using human cancer antigen, PMSA, in the form of an Fc-antigen fusion protein. In FIG. 4A, mice were immunized with 50 μg PSMA fusion protein alone. In FIG. 4B, mice were immunized with 0.05 μg Fc-GMCSF as 50 μg PSMA and adjuvant. In FIG. 4C, mice were immunized with 50 μg Fc-PSMA and 0.5 μg Fc-GMCSF. In FIG. 4D, mice were immunized with 50 μg Fc-PSMA and 5 μg Fc-GMCSF. 4A-4D, square, diamond and triangular shapes represent data from three individual mice.
[74] 5A-5F are graphs comparing antibody responses specific for PSMA antigens administered as natural proteins (5A-5C) or mouse Fc-PSMA fusion proteins (5D-5F). In FIG. 5A, mice were immunized with 50 μg PSMA as antigen. In FIG. 5B, mice were immunized with 0.2 μg GMCSF as 50 μg PSMA and adjuvant. In FIG. 5C, mice were immunized with 50 μg PSMA and 0.5 μg Fc-GMCSF as adjuvant. In FIG. 5D, mice were immunized with 50 μg Fc-PSMA as antigen. In FIG. 5E, mice were immunized with 50 μg Fc-PSMA as antigen and 0.2 μg GMCSF as adjuvant. In FIG. 5F, mice were immunized with 50 μg Fc-PSMA as the antigen and 0.5 μg GMCSF as the adjuvant. 5A-5F, square, diamond and triangular shapes represent data from three individual mice. Antibody concentrations for antigens were measured by ELISA, and the Y-axis represents the optical density of the ELISA readout.
[75] 6 is a chart comparing the adjuvant effect of Fc-GMCSF or Fc-F3L administered with Fc-PSMA in antibody production against human PSMA. All animals were donated 50 μg of Fc-PSMA alone or in combination with Fc-cytokines, designated as adjuvant. Three mice were tested per experiment.
[76] 7A and 7B are graphs showing immunogenicity of individual mice in combination with EpCAM fusion protein alone or in combination with Fc-GMCSF adjuvant. 7A and 7B show antibody titers measured after 7 days and 14 days after additional immunity, respectively. Additional immunization was performed three weeks after the first immunization. In both figures, open diamonds represent mice subcutaneously immunized with 10 μg Fc-EpCAM alone and solid triangles represent mice immunized subcutaneously with 10 μg Fc-EpCAM and 1 μg Fc-GMCSF as an adjuvant. Antibody concentrations for antigens were measured by ELISA, and the Y-axis represents the optical density of the ELISA readout.
[77] 8A and 8B are graphs showing immunogenicity in mice in combination with EpCAM-Fc (reverse orientation of Fc site and antigen) or Fc-GMCSF adjuvant fusion protein. 8A and 8B show antibody titers measured 14 and 21 days after immunization (after 7 additional days of immunization), respectively. In both figures, open diamond shows the average titer of three mice immunized with 25 μg EpCAM-Fc fusion protein, solid triangles immunized with 25 μg EpCAM-Fc and adjuvant with 2.5 μg Fc-GMCSF Mouse. Antibody concentrations for antigens were measured by ELISA, and the Y-axis represents the optical density of the ELISA readout.
[78] 9 is a chart for constructing a plasmid vector encoding EpCAM-Fc-GMCSF fusion protein. In this case, the antigen EpCAM is fused to the amino terminal end of the immunoglobulin heavy chain constant region (Fc region), and the adjuvant GMCSF is fused to the carboxy terminal end of the Fc region.
[79] 10A-10D are graphs showing antibody titers of mice injected with plasmid vectors encoding Fc-EpCAM fusion proteins using PBS or 25% (w / w) sucrose solution as carrier. 10A-10D show antibody titers recorded after 14 days, 27 days, 55 days, and 69 days after the initial injection, respectively. In the figures, open diamonds represent titers for individual mice injected with Fc-EpCAM coding plasmid in PBS, and solid triangles show titers of individual mice injecting Fc-EpCAM coding plasmid in sucrose. Antibody concentrations for antigens were measured by ELISA, and the Y-axis represents the optical density of the ELISA readout.
[80] 11A and 11B are graphs showing the stimulation of ³ H-thymidine insertion in response to laboratory stimulation with antigens of splenocytes isolated from mice immunized by DNA vaccination or protein injection. FIG. 11B is an enlarged view of the lower data of FIG. 11A. In these figures, solid diamonds represent splenocytes cultured from mice immunized with plasmid DNA encoding 100 μg of CMV-Fc-EpCAM fusion protein, and open circles represent 100 μg of CMV-EpCAM-Fc fusion protein. Splenocytes cultured from mice immunized with plasmid DNA encoding are shown, and crosses represent splenocytes cultured from mice immunized with 10 μg of Fc-EpCAM protein. These spleens were removed from mice 70 days after the first injection of plasmid DNA or protein and additional immunization three weeks apart.
[81] 12A and 12B are graphs showing cytotoxic T lymphocyte (CTL) lethal analysis using splenocytes derived from plasmid DNA or Fc-EpCAM protein immunized mice. 12A shows the activity of splenocytes against mouse CT26 tumor cells expressing human EpCAM protein. 12B shows the activity of splenocytes against parental mouse CT26 tumor cells. In both figures, open diamond represents splenocytes immunized with DNA carrying the (CMV-promoter) -EpCAM construct, and open squares immunized with DNA carrying the (CMV-promoter) -Fc-EpCAM fusion construct. Splenocytes derived from mouse, open triangles represent splenocytes derived from mouse immunized with DNA accompanying the (CMV-promoter) -EpCAM-Fc fusion construct, cross-immunized with Fc-EpCAM fusion protein Splenocytes derived from mice are shown. CTL analysis used splenocytes derived from immunized mice incubated for 5 days with 10 U / ml IL-2. The labeled target cells were mixed with the indicated effectors and incubated for 4 hours. The release of radioactivity was used to calculate the rate of specific dissolution.
[82] FIG. 13 is a graph showing antibody titers in mice immunized subcutaneously with 50 μg Fc-MCSP fusion protein in PBS alone or in combination with 5 μg Fc-GMCSF as an adjuvant. Solid diamonds represent antibody titers in normal serum, open squares represent antibody titers in serum of mice immunized with Fc-MCSP fusion protein alone, and solid triangles represent Fc-GMCSF using the Fc-MCSP fusion protein as an adjuvant. The antibody titer in the serum of mice immunized in combination with is shown. The concentration of antibody to the antigen is measured by ELISA, and the Y-axis shows the optical density of the ELISA readout.
[83] 14A and 14B are graphs showing antibody titers in mice immunized with Fc-gp41 pep 626 fusion protein alone or in combination with Fc-cytokine adjuvant. 14A and 14B show antibody titers achieved after 7 days and 33 days after second booster immunity, respectively. In these figures, open diamond represents antibody titers in mice immunized by transdermal injection of 25 μg Fc-gp41 pep 626 antigen alone, open squares represent 25 μg Fc-gp41 pep 626 antigen with 2.5 μg Fc- The titer in mice immunized by transdermal injection in combination with GMCSF adjuvant is shown, and the solid triangles in mice immunized by transdermal injection of 25 μg Fc-gp41 pep 626 antigen combined with 2.5 μg Fc-IL2 adjuvant. Antibody number is shown. The concentration of antibody to the antigen is measured by ELISA, and the Y-axis shows the optical density of the ELISA readout.
[10] Summary of the invention
[11] The present invention is based in part on the discovery that it is possible to enhance the immunogenicity of preselected peptide protein antigens in mammals by fusing a preselected antigen to an immunoglobulin heavy chain constant region. The resulting fusion protein (also referred to as "Fc-antigen fusion protein" or "antigen fusion protein") or nucleic acid sequence encoding the fusion protein is administered to the mammal in the form of a vaccine to elicit an immune response against a preselected antigen. It was also found that the intensity and shape of the immune response elicited against preselected antigens can be controlled by administering specific adjuvants with nucleic acid sequences encoding the Fc-antigen fusion protein or Fc-antigen fusion protein.
[12] Thus, the present invention provides a method for enhancing the immunogenicity of a preselected antigen in a mammal. In one embodiment, the method comprises administering to the mammal an Fc-antigen fusion protein comprising an immunoglobulin heavy chain constant region linked by polypeptide binding to a preselected antigen in an amount sufficient to elicit an immune response. In another embodiment, the method comprises administering to the mammal a nucleic acid sequence, such as a DNA or RNA sequence, that encodes an Fc-antigen fusion protein comprising an immunoglobulin heavy chain constant region fused to a preselected antigen. When a portion of the Fc-antigen fusion protein is administered as a fusion protein or nucleic acid to be expressed in a host to produce a fusion protein, the preselected antigen is a significant amount (eg, by weight or molecular basis) alone of a preselected antigen. (I.e., a preselected antigen that is not fused to an immunoglobulin heavy chain constant region), which is capable of stimulating an immune response in a mammal more strongly.
[13] In addition, the immune response elicited against a preselected antigen of the Fc-antigen fusion protein can be enhanced or modulated by administering the Fc-antigen fusion protein with an adjuvant. Chemical adjuvants such as various adjuvants, Freund's complete adjuvants or oligonucleotides containing unmethylated CpG sequences are useful in the practice of the present invention, but presently preferred adjuvants being used with Fc-antigen fusion proteins are A second Fc-antigen fusion protein (herein referred to as "Fc-antigen fusion protein" or "adjuvant fusion protein") or a nucleic acid encoding an Fc-antigen fusion protein. Preferred Fc-adjuvant fusion proteins include immunoglobulin heavy chain constant regions linked by polypeptide binding to an adjuvant protein (eg, cytokine). Preferred cytokines useful for the production of Fc-adjuvant fusion proteins are, for example, interferon-γ (IFN-γ), interleukin-2 (IL-2), interleukin-4 (IL-4), interleukin-12 (IL-12). ), IL-18, tumor necrosis factor (TNF), granulocyte macrophage colony stimulating factor (GMCSF). Another group of Fc-adjuvant fusion proteins generally comprises an immunoglobulin heavy chain fused to an adjuvant portion corresponding to the extracellular domain of a protein that is partially or wholly bound to the membrane. For example, the CD40 ligand is used as an adjuvant protein fused to the Fc moiety.
[14] Immunity stimulated against a preselected antigen by administering the Fc-antigen and Fc-adjuvant fusion protein simultaneously or sequentially (eg, Fc-antigen followed by Fc-adjuvant or Fc-adjuvant followed by Fc-antigen) You can control the form of the reaction. Two groups of immune responses (denoted Th1 and Th2) are initiated in response to different stimuli to involve different cytokines. Th1-mediated immune responses are usually cellular in nature, while Th2-mediated immune responses are typically humoral in nature. Thus, the Th1 response is useful for attacking modified cells (such as cancer cells or virus infected cells), while the Th2 response is useful for attacking extracellular agents such as parasites. It is often useful to administer cytokines fused to immunoglobulin heavy chain constants to stimulate a general immune response or to initiate or modulate specific Th1 or Th2 responses.
[15] For example, Fc-adjuvant fusion proteins comprising immunoglobulin heavy chain constant regions linked by peptide bonds to GMCSF are potent conventional stimulators of immune responses, including both Th1 and Th2 responses. Fc-adjuvant fusion proteins comprising IL-12 or IFN-γ can be administered together primarily to stimulate a cellular or Th1-mediated immune response. Alternatively, Fc-adjuvant fusion proteins, including IL-4, may be administered to primarily stimulate a humoral or Th2-mediated immune response.
[16] In addition, the selection of specific cytokines present in the Fc-adjuvant fusion protein can affect the group of antibodies generated against the preselected antigens of the Fc-antigen fusion protein. For example, an IL-12 containing Fc-adjuvant fusion protein can stimulate helper T cells and can stimulate production of an IgG2a antibody family. Alternatively, an adjuvant fusion protein containing IL-4 can stimulate the production of an IgE antibody family.
[17] In a preferred embodiment as described above, the method comprises administering the Fc-antigen fusion protein or nucleic acid encoding the Fc-antigen fusion protein in combination with the Fc-adjuvant fusion protein. By using two fusion proteins, each comprising an immunoglobulin heavy chain constant region, both preselected antigens and adjuvant proteins (eg, cytokines) can be localized together in the same or similar cell morphology in mammals. For example, macrophages (B cells), granulocytes, and dendritic cells express Fc receptors on their cell surfaces. Thus, by administering together an Fc-antigen and an Fc-adjuvant fusion protein capable of binding an Fc receptor, the antigen of the antigen fusion protein and the adjuvant of the adjuvant fusion protein can be localized together. The adjuvant can then stimulate, enhance or otherwise modulate the immune response around the preselected antigen.
[18] In this preferred embodiment, the present invention utilizes two prominent ubiquitous or centralized forms. First, the present invention uses a common part (which is concentrated in a specific part of the human body) that can be fused to both an antigen and an adjuvant. In this way, the effective localization of antigen in the neighborhood of the adjuvant is increased. Secondly, the present invention targets antigens to antigen processing and expression mechanisms of the immune system. The first concentration step is performed by fusing the antigen and the adjuvant protein into a concentrated portion in a part of the human body that is easily accessible to the immune system. The second targeting step is carried out by fusing the antigenic protein to any part that enhances the delivery of the antigenic expression system or processing by the antigenic expression system.
[19] Thus, the present invention accomplishes these concentration effects by two alternative methods. One method is to construct and administer two different fusion proteins (antigen-localized protein fusion and adjuvant-localized protein fusion). The second method is to construct and administer a fusion comprising an antigen, an adjuvant, and a localized protein. The Fc moiety is an example of a localized protein.
[20] The important property of the immunoglobulin heavy chain constant region is that, unlike the preselected antigen in the Fc-antigen fusion protein, it is preferred that there is no immunogenicity or weakly immunogenic at the target receptor. In other words, the preselected antigen in the Fc-antigen fusion protein was more immunogenic at the receptor than the immunoglobulin heavy chain constant region. Similarly, Fc-adjuvant fusion proteins have also been observed to be immunogenic or weak at the target receptor. Immunogenicity of immunoglobulin heavy chain constants can in some cases be reduced or eliminated using immunoglobulin constant region sequences similar to or derived from those present in the same species as the target receptor. For example, immunoglobulin heavy chain constant regions, preferably those constants derived from humans, are used to produce fusion proteins administered to humans. Similarly, when the target receptor is human, it is also preferred that the adjuvant protein of the Fc-adjuvant fusion protein is also derived from humans. By selecting the appropriate amino acid sequence-defining immunoglobulin heavy chain constant region and adjuvant protein, one can optimize the immune response mainly directly to the preselected antigen.
[21] In a preferred embodiment, the immunoglobulin heavy chain constant region of the Fc-antigen fusion protein comprises an immunoglobulin hinge region, and optionally an immunoglobulin constant region region selected from the group consisting of CH2 domains, CH3 domains and CH4 domains or combinations thereof. However, it is preferred that the immunoglobulin heavy chain constant region lack at least a CH1 domain. In addition, the Fc fusion protein of the present invention preferably lacks an immunoglobulin heavy chain variable region domain (V _H ). When the fusion protein is administered to a human, the immunoglobulin heavy chain constant portion preferably includes a hinge portion and a CH2 domain or a CH3 domain, and more preferably includes both a hinge portion and a CH2 domain and a CH3 domain. Immunoglobulin heavy chain constant regions useful in the practice of the present invention are directed to any of the five immunoglobulin groups called in the art as IgA (Igα), IgD (Igδ), IgE (Igε), IgG (Igγ), and IgM (Igμ). It may be derived from the belonging immunoglobulin. However, immunoglobulin heavy chain constants derived from the IgG group are preferred.
[22] It has been observed that any preselected antigen of interest can be included in the Fc-antigen fusion protein of the invention. In a preferred embodiment, the preselected antigen is selected from the group consisting of prostate-specific membrane antigens, ectodomains of cytokine receptors, viral proteins and cancer or tumor specific antigens.
[23] Fc-antigen fusion proteins with various conformations may be useful in the practice of the present invention. For example, the N-terminus of a preselected antigen can be linked by polypeptide binding to the C-terminus of an immunoglobulin heavy chain constant. Alternatively, the C-terminus of the preselected antigen can be linked by polypeptide binding of the N-terminus of the immunoglobulin heavy chain constants. It has also been observed that the Fc-antigen fusion proteins may comprise a plurality of one or more preselected antigens that can be linked directly or via a polypeptide linker to each other or to an immunoglobulin heavy chain constant. In addition, two or more Fc-antigen fusion proteins may be linked together non-covalently or covalently, eg, linked by one or more bisulfide bonds to produce a dimeric or multimeric composition. It was observed that the dimer constructs may have the same or different Fc-antigen fusion proteins. For example, although two Fc-antigen fusion proteins contain the same immunoglobulin heavy chain constant region, the preselected antigens may be different. It was observed that similar conformations can be used for the Fc-adjuvant fusion protein.
[24] In addition, various nucleic acid sequences encoding Fc-fusion proteins may be useful in the practice of the present invention. For example, the nucleic acid sequence may encode both immunoglobulin heavy chain constants and preselected antigens or preselected antigens and immunoglobulin heavy chain constants in the 5 'to 3' direction. In addition, the nucleic acid sequence may optionally include a “leader” or “signal” sequence based on, for example, an immunoglobulin light chain sequence fused directly to the hinge portion of an immunoglobulin heavy chain constant. In a preferred embodiment, where the Fc region is based on an IgG sequence, the Fc-region may form a bisulfide bond with at least an immunoglobulin hinge portion (ie, a second immunoglobulin hinge sequence in the 5 'to 3' direction). A hinge comprising one or more cysteine amino acids), an immunoglobulin CH2 domain and a CH3 domain. In addition, a nucleic acid sequence encoding an Fc-antigen fusion protein may be inserted into a recombinant expression vector capable of expressing an Fc fusion protein, eg, capable of expressing a bacterial host, a target receptor, or both.
[25] Injection of the nucleic acid sequence encoding the Fc-antigen fusion protein alone or in combination with the nucleic acid sequence encoding the Fc-adjuvant fusion protein allows the generation of a cellular immune response, a humoral immune response, or both. Combining nucleic acid based immunization and protein based immunization (eg, administration of Fc-antigen fusion protein prior to, during, or after administration of nucleic acid encoding an Fc-antigen fusion protein) results in synergism. Or elicit a stronger immune response to preselected antigens than to immunize with proteins alone.
[26] The foregoing various objects, features and advantages of the present invention will become more apparent from the following detailed description, drawings and claims.
[27] Detailed description of the invention
[28] The present invention provides for the effective use of in vivo protein or peptide antigens to elicit two forms of humoral (ie antibody based) or Th2 cell mediated immune response, cellular or Th1 cell mediated immune response, and in some cases immune responses in mammals. It's about delivery. It has been found that the preselected antigen can be fused with an immunoglobulin heavy chain constant region to produce an Fc-antigen fusion protein to enhance the immunogenicity of a preselected protein or peptide antigen in mammals. The resulting Fc-antigen fusion protein or nucleic acid sequence encoding the Fc-antigen fusion protein can then be administered to a mammal, such as a human, in the form of a vaccine to elicit an immune response against a preselected antigen.
[29] Fc-antigen fusion proteins selectively target antigens to antigen presenting cells (APCs). Without wishing to be bound by theory, it is believed that the binding of Fc-antigen fusion proteins to APC is mediated through Fc receptors expressed on numerous immune cell morphologies, for example, on cell morphologies such as dendritic cells, macrophages, B-cells and granulocytes. . When the Fc-antigen fusion protein is administered to stunts, it binds to the Fc receptor and then the Fc-antigen fusion protein is incorporated intracellularly by APC. Fusion proteins incorporated into cells, including preselected antigens, are then believed to denature into small peptides and appear on the cell surface. The peptides shown subsequently mediate a humoral and / or cellular immune response. Certain forms of stimulated immune response can be controlled by administering Fc-antigen fusion proteins with an adjuvant, eg, an adjuvant fusion protein.
[30] In one form of administration, an Fc-antigen fusion protein is administered to the receptor. In another dosage form, a nucleic acid sequence encoding an Fc-antigen fusion protein is administered to a receptor. Preselected antigens are expressed in the administered Fc-antigen protein or from the administered nucleic acid, thereby exhibiting immunogenicity than the antigen alone (ie, an antigen that has not been fused by polypeptide binding to an immunoglobulin heavy chain constant). Furthermore, under certain circumstances, administration of nucleic acids encoding the same fusion protein after successive administrations of the fusion protein or alternatively the administration of the same fusion protein following administration of the nucleic acid encoding the fusion protein may maximize the immunogenicity of the preselected antigen. Can be used to It was found that the optical immune response is elicited when both components of the Fc-antigen fusion protein are active. That is, a preselected antigen in the Fc-antigen fusion protein can elicit an immune response and the immunoglobulin heavy chain constants can bind the Fc receptor on the APC surface.
[31] In addition, as described above, the intensity and shape of the immune response elicited against a preselected antigen can be controlled by administering with a specific adjuvant having a nucleic acid encoding the Fc-antigen fusion protein and / or the Fc-antigen fusion protein. Can be. Chemical adjuvants (eg, complete or incomplete adjuvant of Alum or Freund) are useful in the practice of the present invention under certain circumstances, such as in veterinary applications, but their side effects such as tissue wounds are not suitable for use in humans. It may be inappropriate. Thus, preferred adjuvants include secondary Fc fusion proteins in which the immunoglobulin heavy chain constants are fused to the adjuvant protein to produce an Fc-adjuvant fusion protein. It is understood that with the Fc-antigen fusion protein, an optimal immune response is elicited if the Fc-adjuvant fusion protein 2 component is active. That is, the adjuvant of the Fc-adjuvant fusion protein can modulate the immune response and the immunoglobulin heavy chain constant portion can bind the Fc receptor on the APC surface.
[32] In a preferred embodiment of the invention, the antigen and the adjuvant are both administered with a nucleic acid or Fc fusion protein encoding said fusion protein. That is, the antigen is administered with the Fc-antigen fusion protein and the adjuvant is administered with the Fc-adjuvant fusion protein. Preferred administration of Fc fusion proteins useful in the practice of the present invention is described in Figures 1A-1G.
[33] 1A exemplarily shows an Fc fusion protein in which the C terminus of the immunoglobulin heavy chain constant region 1 is linked directly or via a polypeptide linker to the N-terminus of a preselected antigen or adjuvant 2. As used herein, "polypeptide linker" is to be understood as meaning one or more series of amino acids that bind together two proteins. Polypeptide linkers are often aminosa sequences of about 10 to 15 residues in length, including, for example, repeat glycine and / or serine residues. 1B exemplarily shows an Fc fusion protein in which the C terminus of a preselected antigen or adjuvant 2 is linked to the N-terminus of the immunoglobulin heavy chain constant region 1 directly or via a polypeptide linker.
[34] 1C depicts a dimeric construct containing two Fc fusion proteins covalently linked via two disulfide bonds. The dimeric construct comprises two Fc fusion proteins with each immunoglobulin heavy chain constant region (1) linked to the N-terminus of the preselected antigen of the adjuvant (2). Similarly, FIG. 1D shows a dimeric construct containing two Fc fusion proteins covalently linked via two disulfide bonds. The dimeric construct comprises two Fc fusion proteins in which the C-terminus of each preselected antigen or adjuvant (2) is linked to the N-terminus of immunoglobulin heavy chain constant region (1).
[35] 1E depicts a dimer construct containing two Fc fusion proteins linked via two disulfide bonds. Said dimeric construct comprises two Fc fusion proteins with the C-terminus of each immunoglobulin heavy chain constant region (1) linked directly or via a polypeptide linker to the N-terminus of a preselected antigen or adjuvant (2); The C-terminus of the antigen or adjuvant is attached to the secondary antigen or adjuvant 2 'directly or via a polypeptide linker.
[36] 1F depicts a dimeric construct containing two Fc fusion proteins linked via two disulfide bonds. The dimeric construct comprises two Fc fusion proteins wherein the C-terminus of the antigen or adjuvant (2) is linked directly or via a polypeptide linker to the N-terminus of the immunoglobulin heavy chain constant region (1), wherein said immunoglobulin The C-terminus of the heavy chain is linked to the N-terminus of another adjuvant or antigen (2 ') directly or via a polypeptide linker. For example, the fusion protein may comprise an antigen-immunoglobulin heavy chain constant region-adjuvant preselected in the N- to C-terminal direction.
[37] 1G depicts a dimeric construct containing two Fc fusion proteins linked via two disulfide bonds. The dimeric construct comprises two Fc fusion proteins wherein the C-terminus of the antigen or adjuvant (2) is linked directly or via a polypeptide linker to the N-terminus of the other adjuvant or antigen (2 '), the other adjuvant The C-terminus of the vant or antigen is linked to the N-terminus of the immunoglobulin heavy chain constant region 1 directly or via a polypeptide linker. For example, the fusion protein comprises an antigen-adjuvant-immunoglobulin heavy chain constant region preselected in the N- to C-terminal direction.
[38] In the practice of the invention, it is generally preferred to place the Fc moiety in the N-terminus relative to the adjuvant moiety. If the adjuvant addition is placed N-terminally to the Fc moiety, the adjuvant-Fc fusion can bind to the adjuvant receptor on mammalian cells and the Fc moiety will be in the same direction adopted if the antibody binds to the cell surface. ADCC or complement binding reactions can occur. However, if the Fc addition is placed at the N-terminus with respect to the adjuvant moiety, the ADCC and complement binding reactions will not appear.
[39] The constructs shown in FIGS. 1C-1G appear as dimers crosslinked by a pair of bisulfide bonds between cysteines on neighboring hinge portions. In the figure, bisulfide bridges are shown to be linked together to a portion of two immunoglobulin heavy chain constants through the hinged nature of these molecules. While constructs, including immunoglobulin hinges, are preferred, the present invention has observed that crosslinking at other locations can be selected as desired. Also, in some cases, two or more monomers may be combined non-covalently to produce dimers or multimers useful in the practice of the present invention.
[40] As used herein, "immunoglobulin heavy chain constant region" may be used interchangeably with "Fc region" and means a site capable of binding to the carboxyl terminus of an immunoglobulin heavy chain constant or homologue or Fc receptor. As is known, each immunoglobulin heavy chain constant region comprises four or five domains. The domains are called in the order of CH1-hinge-CH2-CH3 (-CH4). CH4 is present in IgM that does not have a hinge. The immunoglobulin heavy chain constant portion useful in the practice of the present invention comprises an immunoglobulin hinge, preferably comprising a CH3 domain. Most preferably, the immunoglobulin heavy chain constant portion comprises an immunoglobulin hinge portion, a CH2 domain and a CH3 domain. As used herein, an immunoglobulin “hinge portion” means at least a portion of an immunoglobulin hinge portion sufficient to form one or more bisulfide bonds with the entire immunoglobulin hinge portion or the second immunoglobulin hinge portion.
[41] Suitable immunoglobulin heavy chain constant regions may be derived from antibodies belonging to the respective immunoglobulin groups represented by IgA, IgD, IgE, IgG and IgM, but it has been observed that immunoglobulin heavy chain constants derived from the IgG group are preferred. It was also observed that the immunoglobulin heavy chain constant region can be derived from any IgG antibody called in the art as IgG1, IgG2, IgG3 and IgG4.
[42] The immunoglobulin heavy chain constant domains have cross-homology among the immunoglobulin groups. For example, the CH2 domain of IgG is homologous to the CH2 domain of IgA and IgD and the CH3 domain of IgM and IgE. Preferred immunoglobulin heavy chain constant regions comprise protein domains corresponding to the CH2 and CH3 sites or their functional sites or derivatives of IgG. However, it is preferred that the immunoglobulin heavy chain constant region lack at least a CH1 domain. Moreover, the Fc-antigen or Fc-adjuvant fusion protein optionally lacks an immunoglobulin variable region. In a more preferred embodiment, the immunoglobulin heavy chain constant region comprises an immunoglobulin hinge, a CH2 domain and a CH3 domain from the N-terminal direction to the C-terminal direction, all of which are based on sequences from the IgG molecule. The selection of appropriate immunoglobulin heavy chain constant regions is described in detail in US Pat. Nos. 5,541,087 and 5,726,044. It is believed that within the skill of the art to select specific immunoglobulin heavy chain constant region sequences from specific immunoglobulin groups and subgroups to achieve specific results.
[43] In some cases it may be useful to modify the immunoglobulin heavy chain constants, such as by mutation, deletion or other genetic engineering or other attempts, such that certain activities such as complement binding reactions or antibody dependent cell mediated cytotoxicity (ADCC) Stimulation is reduced or eliminated. However, it should be taken into account that the ability of the immunoglobulin heavy chain constant to bind to the Fc receptor must be maintained.
[44] In the practice of the present invention, it is preferred that the Fc-antigen or Fc-adjuvant fusion protein component of the immunoglobulin heavy chain constant portion is not immunogenic or weakly immunogenic at the target receptor. If the immunoglobulin heavy chain constants fail to produce a detectable antibody response in the direction to the immunoglobulin heavy chain constants, it should be taken into account that the Fc region is not immunogenic or weak. Thus, the immunoglobulin heavy chain constant region must be derived from an immunoglobulin present in the same species as the desired receptor of the fusion protein, or an immunoglobulin based on the amino acid sequence corresponding to such immunoglobulin. In other words, human immunoglobulin constant region sequences should be used when the Fc fusion construct (Fc antigen and / or Fc-adjuvant fusion protein) is administered to a human. Nucleotide and amino acid sequences of human Fc IgG are described, for example, in Ellison et al. (1982) NUCLEIC ACID RES. 10: 4071-4079. In addition, murine Fc sequences should be used when Fc fusions are administered to mice. Nucleotide and amino acid sequences of murine Fc IgG2a are described, for example, in Bourgois et al. (1974) EUR. J. BIOCHEM. 43: 423-435. The same logic would apply if the Fc fusion protein is administered to pets, such as dogs and cats, and other animals, including farm animals such as cows and horses.
[45] The term "preselected antigen" as used herein, alone or in combination with other reagents, means any protein or fragment thereof, or polypeptide capable of inducing an immune response in a mammal. Any such preselected antigen is interpreted to be included in the Fc-antigen fusion protein of the invention. In a preferred embodiment, the preselected antigen is a prostate-specific antigen (PSMA); Ectodomains of cytokine receptors, eg, ectodomains of human IL-4 receptors, tumor-specific antigens (eg, antigens that are unregulated or present in increased concentrations in tumor cells relative to normal cells) ; And viral proteins, eg, proteins encoded by the genome of human immunodeficiency virus (HIV).
[46] As used herein, “adjuvant” means any substance that can act as an immunomodulator, for example by enhancing an immune response (a humoral or cellular immune response) against a preselected antigen. As used herein, "humoral" immunity refers to immunity mediated by antibodies present in body fluids, such as, for example, plasma or lymph, whereas "cellular" immunity is also initiated by T lymphocytes to effector T lymphocytes and And / or immunological response mediated by macrophages.
[47] As noted above, various chemical adjuvants, such as Freund's Complete Adjuvant, will be useful for immunizing mammals other than humans. Although widely used in animals to produce significant cytotoxic T lymphocyte (CTL) responses or high titers of antibodies, they are not suitable for use in humans due to their side effects such as tissue injury. Therefore, there is a need to induce a strong immune response without accompanying inflammation at the injection site. One obvious advantage of using the Fc adjuvant fusion protein of the invention is the ability to induce a strong immune response without the need for chemical adjuvant such as Freund's adjuvant.
[48] Preferred adjuvants useful in the practice of the present invention include Fc-adjuvant fusion proteins or nucleic acids encoding them. Preferred adjuvants included in the Fc fusion protein are cytokines and the like. As used herein, the term “cytokine” refers to T cells in a mammal; B cells; Macrophages; Neutrophils; Eosinophils; Basophils; Dendritic cells; And any protein or peptide analog or functional fragment thereof capable of modulating the activity of immune cells such as their precursors. Preferred cytokines include, for example, IFN-γ, IL-2, IL-4, IL-12, IL-18, TNF and GMCSF. The outer domain of the CD40 ligand is also a preferred protein fused to Fc to produce Fc-adjuvant. When administered in combination with Fc-adjuvant, the antigen in the Fc-antigen fusion protein can elicit a stronger immune response than when administered without the Fc-adjuvant fusion protein. In some cases, the concentration of antigen reached after only two immunizations of the Fc-antigen with Fc-adjuvant is equal to or higher than that obtained using Freund's adjuvant and there is no detectable skin response.
[49] For immunoglobulin heavy chain constant regions of the Fc-antigen or Fc-adjuvant fusion protein, it is preferred that the adjuvant protein is only weakly immunogenic or non-immunogenic in the intended receptor. This can be achieved by incorporation into an Fc adjuvant fusion protein, a cytokine defined by an amino acid sequence corresponding to a cytokine that is separable from the same species as the intended receptor. For example, where the Fc adjuvant fusion protein is administered to a human, it is preferred that the adjuvant protein (eg, cytokine) is of human origin.
[50] Administration of the Fc-antigen and Fc-adjuvant fusion protein simultaneously or one together can modulate the immune response in a stimulated form to a preselected antigen. Two types of immune responses, termed Th1 and Th2, are stimulated in response to different classes of infectious diseases, with different cytokines involved. Th1-mediated immune responses are usually originally cellular, whereas Th2-mediated immune responses are usually original humoral. Thus, the Th1 response may be useful for attacking modified cells, such as tumor cells or virus infected cells, while the Th2 response may be useful for attacking extracellular substances such as parasites. It is often desirable to administer a cytokine fused to an immunoglobulin heavy chain constant region to stimulate a general immune response or to initiate or modulate a Th1 or Th2 specific immune response.
[51] Moreover, the selection of specific cytokines present in the Fc-adjuvant fusion protein can affect the class of antibodies produced against the preselected antigens of the Fc-adjuvant fusion protein. For example, Fc-IL12 stimulates helper T cells by stimulating the production of Th1 cytokines such as IFN-γ, IL-2 and TNF, thereby producing IgG2a class antigen and potent cellular immunity. Enhances. Conversely, Fc-IL-4 stimulates the production of Th2 cytokines such as IL-5, IL-6, Il-10 and IL-4, which enhance humoral immunity.
[52] As mentioned above, in preferred embodiments the method comprises administering the Fc-antigen fusion protein together with the nucleic acid or Fc-antigen fusion protein encoding the Fc-antigen fusion protein. By using two kinds of fusion proteins, each containing an immunoglobulin heavy chain constant region, it is possible to localize both the adjuvant protein (eg, cytokine) and the preselected antigen together in cells of the same or similar type in mammals. . For example, macrophages, B cells, granulocytes and dendritic cells express Fc receptors on their cell surface. Thus, by administering together an Fc-antigen and an Fc-adjuvant fusion protein capable of binding to an Fc receptor, it is possible to localize the adjuvant of an adjuvant fusion protein and the antigen of an antigen-fusion protein together in the same cell fraction of APC. The adjuvant then enhances or modulates the immune response near the preselected antigen.
[53] The combination of Fc-cytokines is used synergistically to stimulate the general response and affect whether it is a cellular (Th1) or humoral (Th2) response. For example, Fc-GMCSF is a powerful general stimulant of the immune response. However, in order to modulate a response to cellular or Th1-mediated immunity, Fc-IL12 or Fc-IFNγ adjuvant protein may be administered with Fc-GMCSF, for example. To further enhance the humoral or Th2 mediated response, the Fc-IL4 adjuvant protein can be administered with Fc-GMCSF, for example, to modulate the response to the production of Th2 cells. Other Th1- or Th2-enhanced cytokines used as fusions to Fc can be used depending on the exact nature of the desired physiological response. This general approach also involves autoimmune reactions (Th1-mediated disease) and allergies (Th2-mediated disease), by manipulating the opposite Th form of the new response away from the harmful and by directing the antigen to more specific antigens. The same can be used to modulate existing pathogenic responses.
[54] In some situations, it is useful to use nucleic acids as adjuvants when immunizing an animal with an Fc-antigen fusion protein. Oligonucleotides containing sequences rich in nucleic acids, for example cytosine-phosphate diester bond-guanosine (Cpg), favor an immune response to the Th1 response and may optionally be used with other adjuvants such as cytokines. See, eg, Brazolot et al. (1998) PROC. NATL. ACAD. SCI. U.S.A. 95: 15553-8; Liu et al. (1998) BLOOD 92: 3730-6; and Klinman et al. (1997) IMMUNOL. 159: 3635-3639. Thus, oligonucleotides containing CpG can be administered with an Fc-antigen fusion to obtain an enhanced and appropriately regulated immune response. Although such nucleic acid molecules can be of any length, nucleotides of 8 or more nucleotides in length are preferred. Do. More preferably, the nucleic acid sequence comprises purine-purine-C-G-pyrimidine-pyrimidine, wherein the cytosine in the central Cpg is not methylated. The frequency of CpG dinucleotides in the adjuvant DNA is preferably about 5% or greater, more preferably about 10%. For example, oligodeoxynucleotide TCCATGACGTTCCTGACGTT (SEQ ID NO: 22) in the form of a double helix can be used as an adjuvant. Depending on the type of immune response desired, it may be useful to mix nucleic acids with alum.
[55] The present invention utilizes conventional recombinant DNA techniques to produce Fc fusion proteins useful in the practice of the present invention. Fc fusion constructs are produced at the DNA level, and the resulting DNA is inserted into an expression vector and expressed to produce the Fc-antigen or Fc-adjuvant fusion protein of the invention. As used herein, the term “vector” refers to a nucleic acid comprising a nucleotide sequence suitable for insertion into a host cell, recombination, insertion into a host cell genome, or replication independently as an episome. Such vectors include linear nucleic acids, plasmids, phagemids, cosmids, RNA vectors, viral vectors, and the like. Non-limiting examples of viral vectors include retroviruses, adenoviruses and adeno-associated viruses. As used herein, "expression" or "gene expression" of an Fc fusion protein refers to transcription of DNA sequences, translation of mRNA templates, and secretion of the Fc fusion protein product. Fc fusion proteins, each comprising IL2, CD26, Tat, Rev, OSF-2, bIG-H3, IgE receptor, PSMA, or gp120, were expressed using expression systems of the type discussed herein. Identical or similar expression constructs are disclosed in US Pat. Nos. 5,541,089 and 5,726,044.
[56] As an alternative to the fusion of proteins by genetic engineering techniques, the protein moiety can be fused using chemical conjugation using conventional chemical crosslinkers.
[57] Basic vectors useful in the practice of the present invention are genetically encoded dihydrofolates engineered by selective markers such as bacterial plasmid sequences for the selection and maintenance of plasmids in this collie and transcriptional regulatory sequences derived from eg SV40 virus. Reductase (DHFR). Expression of the Fc-fusion protein sequence is manipulated by a promoter, optionally an enhancer sequence such as the cytomegalovirus (CMV) promoter and enhancer sequence.
[58] When an Fc-fusion protein or nucleic acid encoding such a fusion protein is administered to a human, the Fc fusion protein-encoding sequence is at least a portion of the immunoglobulin heavy chain or mutant form thereof (preferably, human immunoglobulin g1 gene) in the frame. Preferably in the 5 'to 3' direction using a "leader sequence" derived from, for example, an antibody light chain (L) fused with Fcγ1 domain of). The Fcγ1 domain of the immunoglobulin Fcγ1 gene preferably includes at least a hinge domain and a CH3 domain, more preferably at least a hinge domain, a CH2 domain and a CH3 domain. When the Fc fusion protein is administered to a mouse, preferred nucleic acid sequences encoding immunoglobulin heavy chain constant regions include nucleic acid sequences encoding in the 5 'to 3' direction, hinge domains, CH3 domains and CH2 domains from mouse IgG2a antibodies. The carboxyl terminus of the immunoglobulin heavy chain constant region is modified at the nucleic acid level as needed for ligation using preselected antigens (in the case of Fc-antigens) or immunostimulatory cytokines (in the case of Fc-adjuvant cytokines) in the frame. The DNA encoding the secretion cassette may be a genomic structure or its cDNA structure.
[59] Preferably, the DNA portion encoding the signal sequence encodes a peptide fragment that directs secretion of the Fc fusion protein, and then is cleaved from the remaining Fc fusion protein. The signal sequence of the present invention is a polynucleotide that encodes an amino acid sequence that initiates the transport of a protein across a membrane of endoplasmic reticulum. Signal sequences useful in the present invention include antibody light chain signal sequences, such as antibody 14.18 (Gillies et al. (1989) J, OF IMMUNOL. METH., 125: 191), antibody heavy chain signal sequences, such as MPOC141 antibody heavy chain signal. Sequence (Sakano et al. (1980) NATURE 286: 5774), and any other signal sequence known in the art (see, eg, Watson (1984) NUCLEIC ACIDS RESEARCH 12: 5145).
[60] Signal sequences are well characterized in the art and are commonly known to contain 16-30 amino acid residues, and may have more or less amino acid residues. A typical signal peptide consists of three regions: a basic N-terminal region, a central hydrophobic region and a more polar C-terminal region. The central hydrophobic region contains 4 to 12 hydrophobic residues, which anchor the signal peptide across the membrane lipid bilayer upon transport of the immature polypeptide. Following initiation, the signal peptide is cleaved in the cavity of the endoplasmic reticulum by a cellular enzyme, commonly known as a signal peptidase. Potential cleavage sites for signal peptides generally follow the "(-3, -1) rule". Thus, conventional signal peptides have small neutral amino acid residues at the -1 and -3 positions, which lack a proline residue. Signal peptidase will cleave this signal peptide between -1 and +1 amino acids. Thus, the signal sequence can be cleaved from the amino acid-terminus of the fusion protein upon secretion. As a result, secretion of the Fc fusion protein occurs. Signal peptide sequences useful in the practice of the present invention are well known in the art. Von Heijne (1986) NUCLEIC ACIDS RES. 14: 4683.
[61] As is well known to those skilled in the art, the suitability of a particular signal sequence for use in a secretion cassette may require some formalized experiments. Such experiments include measuring the ability of the signal sequence to direct the secretion of the Fc fusion protein and / or determining the optimal placement of the genome or cDNA used to obtain an effective secretion of the Fc fusion protein. One skilled in the art can also produce synthetic signal sequences that follow the rules set forth in von Heijne above, and can test the effectiveness of such synthetic sequences by standardized experiments. "Signal sequence", "signal peptide", "leader sequence" or "leader peptide" is used interchangeably herein.
[62] A variety of other methods of administering Fc fusion proteins or nucleic acid sequences encoding fusion proteins can be used to immunize receptors against preselected antigens. Two different applications of the present invention are used, one based on the injection of DNA encoding the Fc-antigen fusion protein and the second based on the administration of an Fc-antigen fusion protein capable of delivering the protein to the type 1 MHC pathway. Can cause a CTL reaction.
[63] Injection of protein antigens is typically used to induce an immune response in a mammal. But. The invention also provides a method of delivering an antigen to APC by DNA injection. A commonly used technique is to intramuscularly inject a DNA expression vector encoding an antigenic protein. Although protein antigens are expressed by muscle cells, it is reported that antigens are not presented to the immune system by these cells. Instead, it is believed that specified APCs, such as macrophages and dendritic cells, migrate to the injection site, capture the antigen, and present the antigen through a process not yet known in detail. The process can be made efficient by using Fc-antigen fusion protein expression vectors because the secreted fusion proteins bind to APC more efficiently than naïve antigen proteins.
[64] One consequence of the DNA injection approach is that it can often cause both humoral and cellular responses. Typically, exogenously administered proteins are more difficult to enter the route for presentation on MHC type 1 molecules. Nevertheless, administration of the Fc fusion protein of the present invention enhances the production of cytotoxic cells, which will be via MHC type 1 presentation of preselected exogenous antigens. The combination of DNA immunization and protein immunization can also act synergistically to first challenge the immune system and then enhance the level of response in the form of both antibody production and cytotoxic cellular responses. Administration of Fc-adjuvant fusion proteins such as Fc-IL-2, Fc-GMCSF, Fc-IL-12, and Fc-Flt3 ligands together with Fc-antigen fusion proteins is the same cell fraction of APC. Make sure to be ubiquitous together. This stimulates a stronger immune response against a preselected antigen.
[65] Compositions of the invention (ie, Fc-antigens and / or Fc-adjuvant fusion proteins, or nucleic acid sequences encoding such proteins) can be directly (eg, topically, injected into the animal by any means). Topical administration to a transplant or tissue site) or systemically (eg, parenterally or orally). The composition is parenterally (e.g., intravenous, subcutaneous, intraocular, intraperitoneal, intramuscular, buccal, rectal, intravaginal, intraorbital, intradermal, intracranial, intracranial, spinal, intraventricular, intrathecal ), Intratrasternal, intracapsular, intranasally or by aerosol administration, the composition preferably comprises a portion of a fluid suspension or solution that is water soluble or physiologically compatible. Thus, the carrier or vehicle should be physiologically acceptable and not adversely affect the electrolyte and / or volume balance of the patient, in addition to delivering the desired composition to the patient. Therefore, the fluid medium for the medicament may comprise normal physiological saline (eg 9.95% aqueous NaCl 0.15 M, pH 7-7.4).
[66] The preferred dose of the Fc-antigen fusion protein at a single dose is 50 ng / m ² to 1 g / m ² , preferably 5 μg / m ² to 200 mg / m ² , and 0.1 mg / m ² to 50 mg most preferred is / m ² . The preferred dose of the Fc-adjuvant fusion protein at a single dose is 1 ng / m ² to 0.1 g / m ² , more preferably 0.5 μg / m ² to 20 mg / m ² , and 10 μg / m ² to Most preferred is 5 mg / m ² . Preferred doses of nucleic acid encoding Fc-antigen and Fc-adjuvant fusion protein are 1 μg / m ² to 100 mg / m ² , and more preferably 20 μg / m ² to 10 mg / m ² at a single dose. Most preferably, 400 μg / m ² to 4 mg / m ² .
[67] It is contemplated that maximal immunization can be achieved by multiple individual immunizations, eg, one to three inoculations at intervals of about three to six weeks. In addition, as described above, a maximum immune response can be obtained in certain situations by alternating an Fc fusion protein with a nucleic acid encoding such a fusion protein. The Fc-antigen fusion protein encoding a fusion protein or nucleic acid encoding this fusion protein can be administered before, after or simultaneously with the Fc-adjuvant fusion protein or nucleic acid encoding it. However, the optimal mode of administration, dose and immunization method can be determined by conducting well-formed experiments in the art.
[68] The invention is illustrated in more detail by the following non-limiting examples.
[84] Example 1
[85] Construction of Fc-antigens and Fc-adjuvant expression vectors
[86] To properly test the immunogenicity of the Fc fusion protein in a mouse model, an expression vector was constructed using nucleic acid sequences encoding the mouse IgG2a Fc region. This reduces the risk of the Fc region of each fusion protein that causes an immune response in mammals. In addition, mouse cytokines were used as fusion partners in the Fc-adjuvant fusion proteins because their biological activity can be highly species specific. Thus, the previously reported vector (Lo et al. (1998) PROTEIN ENGINEERING 11: 295-500) was modified by replacing the human IgG1 Fc sequence with a sequence from cDNA encoding mouse IgG2a Fc (US Pat. No. 5,726,044). (See Figure 2).
[87] Mouse IgG2a Fc sequences were cloned from mouse spleen cell libraries by polymerase chain reaction (PCR) amplification. PCR primers included an adapter sequence for binding a specific Sma I / Xma I restriction site at the 3 'end and a leader sequence at the 5' end to link with the sequence encoding the antigen or adjuvant cytokine. Antigen and adjuvant (cytokine) sequences were made with the 5 'Sma I site and maintained the Xho I site located immediately after the reading frame and transcriptional interruption signal between the Fc and the antigen or adjuvant protein.
[88] The resulting DNA construct was fused directly to the hinge region of the mouse IgG2a H chain and encoded a contiguous light chain leader sequence via mouse IgG2a CH2 and CH3 exons and fusion partners (antigen or adjuvant cytokines). Transcription was regulated by the CMV promoter / enhancer, which has been found to be useful for expression in most types of cells in culture, and in muscle and other cell types after DNA in vivo injection. A selectable dihydrofolate reductase (DHFR) marker gene was included into each vector to facilitate the selection of stably transfected clones, which was the sequence required for the maintenance of plasmid DNA in this collie.
[89] The example Fc-antigen constructs described below are prepared by injecting appropriately adapted sequences between the specific Sma I to Xho I sites in the designed vector pdCs-muFc, where "mu" indicates that the Fc is of mouse origin. It became.
[90] The ectodomain (extracellular portion) of the human IL4 receptor (IL-4R) was cloned by PCR amplification from human peripheral blood mononuclear cells (PBMC). The primers used were 5 'GTCCCGGGTATGAAGGTCTTGCAGGAGC (SEQ ID NO: 1) and 5' CCCCTCGAGCTAGTGCTGCTCGAAGGGCTCCCTG (SEQ ID NO: 2), which contained Sma I and Xho I sites, respectively, for insertion into the pdCs-muFc vector. For this purpose, PCR reaction conditions were used, and the following cloning is as follows. Benefits of KlenTaq and Polymerase Mix (Clontech, Palo Alto, Calif.) And specific primers were used to amplify the gene of interest. The reaction mixture contained 10 mM Treis-HCl, pH 8.3, 50 mM KCl, 1.5 mM MgCl ₂ , 0.01 gelatin (w / v), 0.2 mM dNTP and 1.25 units KlenTaq, respectively, in a total volume of 100 ml. PCR was repeated 30 times, each cycle consisting of 1 minute heat denaturation at 94 ° C., annealing at 42 ° C. for 45 seconds, and 1 minute primer extension at 72 ° C. The amplified product was then subcloned into the SK vector and its sequence was verified by standard sequencing techniques.
[91] Ectodomain of human prostate specific membrane antigen (PSMA) was used with primers 5 'AAGCTTAAATCCTCCAATGAAGC (SEQ ID NO: 3) and 5' CTCGAGTTAGGCTACTTCACTCAAAG (SEQ ID NO: 4) for sense and antisense strands respectively from LnCAP prostate carcinoma cell line (ATCC CRL1740). Cloned by PCR. DNA sequences were identified and PCR fragments were inserted into the pdCs-muFc vector to prepare pdCs-muFc-PSMA fusion constructs.
[92] The ectodomain of human EpCAM (known as KS antigen), an unregulated epithelial cell surface protein in most carcinoma cells, primers 5 'CCCCGGGTAAACAAACAGGAAGAATGTGTCTGTG (SEQ ID NO: 5) and 5' CTCGAGTCATTTTAGACCCTGCATTGAG (sense and antisense strands from LnCAP cells, respectively) Cloned by PCR using SEQ ID NO: 6). DNA sequences were confirmed by standard sequencing techniques and PCR fragments were inserted into the pdCs-muFc vector to produce a pdCs-muFc-EpCAM fusion construct. Another vector was constructed using the EpCAM ectodomain as an N-terminal fusion partner, in which case the PCR product contained a mature ectodomain sequence to the boundaries of the natural leader and membrane spanning domain of the EpCAM cDNA. The 3 'end of the PCR product contained an Afl II site engineered for ligation of the murine Fc fragment to the Afl II site. PCR primers used included 5 'TCTAGAGCAGCATGGCGCCCCCGC (SEQ ID NO: 7) and 5' CCTTAAGCACCCTGCATTGAGAATTCAG (SEQ ID NO: 8). In this case, the murine lacked the 3 'insert for fusion protein insertion, but contained a transcription termination signal at the end of the Fc coding sequence.
[93] The relatively conserved region of the membrane proximal portion of HIV gp41 (from the Hind III site to the lysine residues adjacent to the membrane-spanning site) was expressed as an Fc fusion protein as an example of a short polypeptide antigen sequence. Although protein sequences from HIV IIIB strains were used, coding sequences were optimized for optimal eukaryotic cell expression using high amounts of GC codon bias. DNA sequence encoding amino acid residues 626 to 669 having the following sequence: C CCG GGA TCC CTG ATC CAC TCC CTG ATC GAG GAA TCC CAG AAC CAG CAA GAG AAG AAC GAG CAG GAG CTG CTG GAG CTC GAC AAG TGG GCC TCC CTG TGG AAC TGG TTC AAC ATC ACC AAT TGG CTG TGG TAC ATC AAG TGA CTC GAG (SEQ ID NO: 9) was chemically synthesized and linked into the pdCs-muFc vector. The amino acid sequence of the fusion polypeptide was SLIHSLIEESQUQQEKNEQELLELDKWASLWNWFNITNWLWYIK (SEQ ID NO: 10).
[94] Using sequences encoding other HIV proteins, Fc-antigen fusion proteins (US Pat. Nos. 5,541,087 and 5,726,044) as described above were constructed using mouse IgG2a but not native human IgG1 Fc. These constructs represent another embodiment of the present invention.
[95] A series of Fc-adjuvant (cytokine) fusion proteins comprising mouse IgG2a Fc and several mouse cytokines were constructed in the same manner as in the Fc-antigen fusion protein. Specific cytokines and cloning primers will be described later.
[96] Mouse IL-2 was cloned from murine PBMC by PCR using PCR primers (sense) 5 'GGCCCGGGTAAATCACCCACTTCAAGCTCC (SEQ ID NO: 11) and (antisense) 5' CCCTCGAGTTATTGAGGGCTTGTTG (SEQ ID NO: 12).
[97] Mouse GMCSF was cloned from murine PBMC by PCR using PCR primers (sense) 5 'CCCGGGAAAAGCACCCGCCGCTCACCC (SEQ ID NO: 13) and (antisense) 5' CTCGAGTCATTTTTGGCTTGGTTTTTTGC (SEQ ID NO: 14).
[98] The murine Flt3 ligand was cloned from the murine thymus by PCR using PCR primers (sense) 5 'CAAGCTTACACCTGACTGTTACTTCAGC (SEQ ID NO: 15) and (antisense) 5' CTCGAGTCAAGGCTCTGGGAGCTCCGTGGC (SEQ ID NO: 16).
[99] Mouse IL-12p35 was cloned from murine PBMC by PCR using PCR primers (sense) 5 'CCCCGGGTAGGGTCATTCCAGTCTCTGG (SEQ ID NO: 17) and (antisense) 5' CTCGAGTCAGGCGGAGCTCAGATAGC (SEQ ID NO: 18).
[100] Mouse IL-2 p40 was cloned from murine PBMC by PCR using PCR primers (sense) 5 'TCTAGACCATGTGTCCTCAGAAGCTAAC (SEQ ID NO: 19) and (antisense) 5' CTCGAGCTAGGATCGGACCCTGCAG (SEQ ID NO: 20).
[101] All PCR products except mouse IL-2 p40 were cloned as Sma I to Xho I fragments and analyzed by standard DNA sequencing techniques to link to the pdCs-muFc vector containing the murine Fc of IgG2a as the Fc site. The mouse IL-12 p40 PCR product was expressed in CMV promoter enhancer, a light chain leader sequence fused directly to the mature mouse p40 subunit of IL-12, and a vector containing a neomycin resistance gene in place of the DHFR selective marker in the pdCs-muFc vector, respectively. (Not as an Fc fusion protein). The resulting vector is named pNC-mp40, where "N" represents the neomycin selection gene.
[102] All plasmid constructs induced secretion and synthesis of specific fusion proteins by transient expression in human kidney 293 cells. Briefly, plasmids were introduced into human kidney monolayer cells 293 by coprecipitation with calcium phosphate (Sambrook et al. (1989) MOLECULAR CLONING-A LABORATORY MANUAL, Cold spring harbor, N.Y.). The cells were left overnight (16 hours) and washed with PBS to feed fresh cell culture medium (DMEM containing 10% fetal calf serum (FBS)). After 2-3 days, Fc specific ELISA for fusion proteins secreted using antibodies specific for mouse IgG-Fc protein (Gillies et al. (1989) J. IMMUNOL. METHODS 125: 191). The culture medium was tested by. In the case of mouse Fc-IL12, both Fc-p35 and p40 expressing plasmid DNA were transiently expressed in the same cell culture, so that heterodimeric cytokine fusion proteins were combined prior to secretion excretion of cells (Gillies et al. (1998). J. IMMUNOL. 160: 6195).
[103] Subsequently, stably transfected cells expressing the Fc fusion protein were produced by introducing linearized DNA into mouse NS / 0 myeloma cells by standard electrophoretic techniques. Briefly, cells were suspended at 10 ⁷ cell counts / ml in Gin Pulsor cuvette (Biorad), 0.5 ml of the suspension was mixed with 10 μg of DNA and the mixture was cooled on ice for 10 minutes. Electrophoresis was performed using a Gene Pulsar (Biorad) set at 0.25 V and 500 μF. The cells were recovered on ice for 10 minutes, after which they were resuspended in growth medium and transferred to 96-well plates. Starting on day 2 after electrophoresis, cells were fed every 2-3 days with selection medium containing 0.1 μM methotrexate. Drug-resistant colonies growing in 96-well plates were tested for their expression by Fc ELISA protocol.
[104] For expression of the mouse Fc-IL12 fusion protein, the transfected NS / 0 transfected cell line already expressing the p40 subunit of mouse IL-12 was transfected with a mouse Fc-p35 subunit expression vector as described above. P40 expressing cell lines were obtained by electrophoresis of NS / 0 cells with a mouse pNC-mp40 vector as described above, and selection from medium containing neomycin analog G418 (Life Science Technology). After the second transfection, surviving cell clones were screened by Fc ELISA and mouse IL-12 ELISA (Genzyme, Cambridge, Massachusetts). ,
[105] Structural integrity of the resulting fusion protein was tested by SDS-polyacrylamide gel electrophoresis (SDS-PAGE). Initially, the fusion protein was bound to a small volume (10-20 μl per medium) of Protein A Sepharose (Repligaen, Needleham, Mass.). The bound material was washed with PBS containing Tween-20 (0.01%) and then eluted in gel buffer containing SDS and then boiled for 2 minutes in the presence of 5% 2-mercaptoethanol. The reduced protein was then run on a pre-cast SDS-PAGE gel and stained with Coumaji Blue. Large-scale purification was performed using Protein A Sepharose columns (Repligen, Needleham, Mass.) From stable cell clones according to the manufacturer's instructions.
[106] Example 2
[107] Effect of chemical or Fc-cytokine adjuvant on immunogenicity and antibody production of Fc-antigens
[108] The mouse Fc-huIL-4R alpha subunit constructs prepared in Example 1 were used as antigens to test potential APC-targeting effects of these proteins in animal models. Represents a molecule well conserved between species, with at least 50% sequence identity between mice.
[109] Mice were injected subcutaneously with 50 μg of Fc-antigen fusion protein (Fc-IL-4R) in PBS or Freund's complete adjuvant (CFA). Some groups also received a 5 μg dose of Fc-adjuvant protein (mixed with Fc-IL-4R) of Fc-IL2 or Fc-GMCSF. Two weeks later, the mixtures were administered intraperitoneally to mice. CFA preparations produced micelles that form sustained-release antigen sources that allow continuous stimulation of the immune system. In addition, mycobacterial proteins in CFA induced a strong inflammatory response through cytokine stimulation, thereby further enhancing the immune response. However, CFA causes serious side effects, including skin damage, and therefore cannot be used in humans. Mixtures of Fc-adjuvant fusion proteins in PBS have not been shown to cause any discernible skin reactions or obvious signs of any toxicity in any animal.
[110] Two weeks after immunization (ie, 28 days after the first injection), the animal's blood was drawn to coagulate whole blood in a micropurge tube, and the supernatant was collected by spinning the coagulated material and cells for 5 minutes at a high speed of 12000 RPM. . The resulting serum was diluted with assay buffer (PBS containing 0.01% Tween-20) and tested for antibodies reactive with human IL-4R. Antigen specific ELISAs were performed using 96-well plates coated with human Fc-huIL-4R. 100 μl of 5 μg / ml in PBS was added to each well and incubated at 4 ° C. overnight. The plate coated with antigen was then washed and blocked with blocking buffer (1% BSA, 1% in PBS, 0.01% Tween-20) before use. Test serum dilutions were incubated in the wells for 2 hours at room temperature, then the wells were washed eight times with assay buffer. After addition of a secondary anti-mouse Fc-specific horse radish peroxidase-conjugated antibody (1: 2000 dilution, Jackson ImmunoResearch), the plates were incubated for an additional hour. After an additional eight washes with assay buffer, o-phenylenediamine dihydrochloride (OPD) solution containing 25 mM citric acid, 50 mM Na ₂ HPO ₄ , pH5 and 0.03% freshly added H ₂ O ₂ was added. Added. The reaction was stopped after about 30 minutes by adding 100 μl of 4N H ₂ SO ₄ . The resulting plate was read at 490 nm in a plate reader which automatically subtracted the background reading at 650 nm. The results were plotted as optimal concentration versus serum dilution. Comparative antibody titers were determined, for example, by the amount of serum to be diluted before the optical concentration dropped below any value of 1 OD unit.
[111] The results of the immunization protocol are shown in FIG. 3. Injection of mouse Fc-IL-4R fusion protein alone in PBS by this protocol induced an antibody response in only one mouse (FIG. 3B). However, addition of CFA caused a response in more mice, but titer was nearly identical to that in mice injected with Fc-IL4R fusion protein in PBS (FIG. 3C). The combination of Fc-IL4R and mouse Fc-IL2 adjuvant in PBS induced responses in all animals, but the amount of antibody produced in each case was different (FIG. 3D). Combination of CFA and mouse Fc-IL2 adjuvant (FIG. 3A) had higher titers compared to single administration, respectively (FIGS. 3C and 3D). Combination of mouse Fc-GMCSF adjuvant in PBS showed the strongest immune response in all groups (FIG. 3E) and included the group immunized with a combination of both Fc-GMCSF adjuvant and CFA (FIG. 3F). In other words, it was clear that mouse Fc-GMCSF adjuvant in PBS requires the use of CFA when administered with the mouse Fc-IL4R antigen. This method was thought to be more suitable for use in humans.
[112] Example 3
[113] Effect of Fc-GMCSF Adjuvant Dose on Antibody Produced Against PSMA in Cancer Antigen, Fc-PSMA Fusion Protein
[114] PSMA represents a tumor associated target antigen of humans currently of interest by limited normal tissue distribution. PSMA is currently being tested in clinical trials as a tumor vaccine candidate. In this example, the immunogenicity of the PSMA antigen in the Fc-PSMA fusion protein was evaluated.
[115] Mouse Fc-PSMA fusion protein was prepared in the same manner as in Example 1. Mice were injected subcutaneously with 50 μg of mouse Fc-PSMA in PBS with varying concentrations of Fc-adjuvant fusion protein Fc-GMCSF and then immunized by intraperitoneal injection 14 days later. Antibody titers were determined by Fc-PSMA antigen capture ELISA as described in Example 2 for the Fc-IL4E fusion protein. The results are plotted in FIG. 4 as antibody titers (dilution when OD decreased to 1) versus time after initial injection.
[116] In the absence of Fc-GMCSF, mice had antibody titers against PSMA ranging from 1000 to about 20,000 (FIG. 4A). When combined with 0.05 μg of Fc-GMCSF, the titer was 30,000 to 140,000 (FIG. 4B). A 10-fold increase in Fc-GMCSF increased antibody titers against this cancer antigen (FIGS. 4C and 4D). The highest dose given (5 μg Fc-GMCSF fusion protein per mouse) shows only about 2 μg GMCSF at one injection, which had no systemic signs of animal immunization or apparent effect on mouse skin (FIG. 4D). . In addition, unlike CFA, there was no apparent enlargement in the spleen.
[117] Example 4
[118] Effect of Fc-mediated PSMA Delivery on Antibody Responses to Immunization
[119] The specific effect of the Fc component in the Fc-antigen and Fc-adjuvant fusion protein was tested by comparing the immune response induced in mice injected with the fusion protein, non-fusion antigen or adjuvant protein, or a mixture of the foregoing. Human PMSA system was used for this purpose.
[120] Unfused PSMA was prepared by proteolysis of human Fc-PSMA fusion protein (Lo et al. (1998) PROTEIN ENGINEERING 11: 295-500) using plasmin according to the manufacturer's instructions. Released Fc and undigested Fc-PSMA were removed by adsorption on Protein A Sepharose (Repligen, Needham, MA).
[121] In the mouse group (n = 3) PSMA 50 μg alone (FIG. 5A), or 0.2 μg GMCSF (FIG. 5B) and 0.5 μg Fc-GMCSF (FIG. 5C) (0.5 μg Fc-GMCSF contains 0.2 μg GMCSF); Administered subcutaneously together. In another set of mice, each mouse was administered subcutaneously with only 0.5 μg Fc-PSMA fusion protein alone (FIG. 5D), or 0.2 μg free GMCSF (FIG. 5E) or 0.5 μg Fc-GMCSF (FIG. 5F). All injection formulations were in PBS without chemical adjuvant. Antibodies reactive to mouse Fc-PSMA were measured 14 days after immunization.
[122] The importance of the Fc component of the Fc-antigen fusion protein in the Fc-PSMA fusion protein for immunogenicity of PSMA was significant when animals were injected with PBS preparations without chemical adjuvant. There was substantially no first immune response to PSMA administered in PBS (FIG. 5A). The addition of GMSCF or Fc-GMSCF to immunization had little effect (except for the weak response in one animal) (FIG. 5B) (FIGS. 5B and 5C). In contrast, animals injected with Fc-PSMA alone showed a strong first immune response in all cases (FIG. 5D). Adding free GMSCF to Fc-GMSCF slightly enhanced the effect (FIG. 5E), but co-administering both antigen and cytokine as Fc fusion protein produced the highest level of response (FIG. 5F).
[123] These results show that the combination of Fc-antigen and Fc-adjuvant is particularly useful for inducing an immune response and is clearly advantageous for localizing antigens and stimulatory cytokines (possibly) together in vivo with APC.
[124] Example 5
[125] Comparison of Adjuvant Effects of Fusion Proteins Fc-GMSCF or Fc-Flt3L
[126] Ligands for Flt3, known as Flt3 ligands (Flt3L), are known to play an important role in the development and maturation of dendritic cells (Soligo et al. (1998) BR. J. HAEMATOL. 101: 352-63). Together with tissue macrophages, dendritic cells are considered to be the most important APCs. In a study in mice, daily injections of 10 days increased the APC activity and number of recoverable dendritic cells from lymphoid tissue, and these cells were shown to be very potent in presenting antigens to CD4 + and CD8 + cells. Langerhans cells in the skin are believed to represent some form of dendritic cells that can be captured and migrate to local lymph nodes and present antigen. Since most dendritic cells do not exhibit the Fc receptor array commonly found on macrophages (eg, FcνRI), it was not possible to predict whether the colocalization effect of Fc fusion proteins was associated with this APC.
[127] To test whether Flt-3L acts as an adjuvant, mice were injected with Fc-PSMA and mouse Fc-Flt3L, rather than using mouse Fc-GMCSF fusion proteins (potent stimulators of macrophages and granulocytes). . In this case, any adjuvant effect was thought to be mediated by activation and capture of dendritic cells, which ultimately result in an antibody response to PMSA. The results are shown in FIG.
[128] This study means that mouse Fc-Flt3L is a potent adjuvant that stimulates at least the same amount of Fc-GMCSF and anti-PSMA antibodies. This result means that the combination of Fc-antigen and Fc-adjuvant can be particularly potent in inducing an immune response. The results also show that it is clear that dendritic APCs can be targeted by Fc-cytokines and Fc-antigens as well as APCs, suggesting that more than one form of Fc-receptor is present on these cells.
[129] Example 6
[130] Fc-EpCAM and DpCAM-Fc Fusion Proteins
[131] Another potentially important human cancer antigen, EpCAM (also KSA and 17-1A antigen), was prepared as a fusion protein with a mouse IgG2a Fc site using plasmids and methods as described in Example 1, alone or It was administered with Fc-GMCSF as adjuvant. Mice were subcutaneously administered and further challenged three weeks later with 1 μg Fc-GMCSF and 10 μg Fc-EpCAM in PBS. Control mice were not administered Fc-GMCSF. Titers of antibodies specific for EpCAM were measured 7 days (FIG. 7A) and 14 days (FIG. 7B) after further vaccination. This result indicates that Fc-EpCAM is a potent immunogen when administered alone (open diamond) and that Fc-GMSCF can further enhance the response to this antigen (clogged triangle).
[132] In addition, the EpCAM antigen was expressed in reverse for the Fc fragment as EpCAM-muFc (see Example 1 and FIG. 1B). This molecule was used to immunize Balb / c mice by subcutaneous injection. High doses of EpCAM-Fc fusion protein were used (25 μg per dose) and the amount of adjuvant (2.5 μg Fc-GMCSF) was also increased. Titers of antibodies specific for EpCAM were measured 14 days (FIG. 8A) and 21 days (FIG. 8B) after immunization. EpCAM-Fc fusion protein alone had sufficient immunogenicity in the absence of Fc-GMCSF (FIGS. 8A and 8B, open diamond). The addition of Fc-cytokines improved the titer of the antibody by about three times (FIGS. 8A and 8B, black triangles).
[133] To test whether an immune response to EcCAM can protect mammals from tumor cells expressing these antigens, tails of mice immunized with non-immunized mice or with EpCAM-Fc fusion proteins (Fc-cytokines in some cases) 10 ⁵ CT26 mouse colon cancer cells transfected with human EpCAM were intravenously injected (Gillies et al. (1998) J. IMMUNOL. 160: 6195). After 21 days, the weight gain difference that contributes to the mass of the tumor by killing the animal and staging the degree of lung metastasis in terms of surface coating of the lung, and by measuring the lung weight and comparing it to the lung of a normal animal It was evaluated by measuring. The results presented in Table 1 indicate that tumor metastasis was statistically significantly reduced in mice immunized compared to control mice, including animals immunized with EpCAM-Fc fusion protein. The same result was obtained when using an Fc-EpCAM fusion protein as an antigen.
[134] Treatment groupTransition scoreAv lung weight (mg) Control4, 4, 4, 1, 1412 ± 130 EpCAM-Fc0, 0, 0, 0, 0210 ± 21 EpCAM-Fc + Fc-GM0, 0, 0, 0, 0240 ± 19 EpCAM-Fc + Fc-IL20, 0, 0, 0, 0230 ± 19
[135] The metastasis score is based on the surface coating of the lung using the following equivalence: 1 = 1-25% coverage; 2 = 26-50% coverage; 3 = 51-75 coating; And 4 = 76-100% coverage
[136] Example 7
[137] Combination of Antigen-Fc and Cytokine Adjuvant in a Single Fusion Protein
[138] The protein described in Example 6, EpCAM-Fc, illustrates an N-terminal antigen linked to an immunoglobulin Fc site, such as a carboxyl protein domain. This protein and similar other proteins can be administered with an Fc-fusion protein, such as an Fc-cytokine, to enhance the immune response to the antigen. Alternatively, the antigen, immunoglobulin heavy chain constant region and adjuvant protein (eg, cytokines) can be produced as one fusion protein, eg, EpCAM-Fc-GMCSF fusion protein.
[139] Expression plasmids of this protein were constructed using murine IgG2a Fc and GM-CSF sequences, and the constructs could be evaluated in a mouse model. Small XbaI to Sma I fragments containing the leader-EpCAM-Fc coding sequence were obtained from the native EpCAM-Fc expression vector (Example 1) and linked to the large Sma I to Xba I fragments of the Fc-GMCSF expression vector (FIG. 9).
[140] The resulting vector, pdCs-EpCAM-Fc-GMCSF, was introduced into 293 cells using calcium phosphate precipitation for transient expression and into NS / 0 cells using electrophoresis for stable expression. Cells were cultured in medium containing methotrexate (0.1 μM) to select stable transfectants. Expression clones were confirmed by Fc ELISA (see Example 1), and high levels of producers were widely distributed in the culture. EpCAM-Fc-GMCSF protein was purified from conditioned media by binding to and eluting Protein A Sepharose (Repligen, Needleham, Mass.), And structural integrity was analyzed by SDS-PAGE followed by 2- Reduced to mercaptoethanol. The results indicated that the protein had a molecular weight of about 90 kDa, as predicted for single chain fusion of EpCAM and GMCSF.
[141] To compare the relative immunogenicity of bound fusion proteins, mice were injected subcutaneously with EpCAM-Fc-GMCSF combined and their respective fusion proteins: EpCAM-Fc and Fc-GMCSF combined. The same injection was administered 14 days later and the specific antibody reactivity of human EpCAM was tested 7 days after further antigen inoculation. The same approach has been used for other stimulatory cytokines such as IL-2, IL-12 and Flt3L as well as other protein or peptide antigens.
[142] Example 8
[143] Immunization of Fc-antigens by DNA Injection
[144] The same expression vectors as used for transfection and production of mouse Fc-EpCAM and EpCAM-Fc in mammalian cells were injected as "naked" plasmid DNA into the hind limb muscles of the Balb / c mouse group. DNA was injected at a concentration of 0.5 mg / ml and a total amount of 100 μg was administered in PBS or in 25% (w / v) sucrose solution. Injections were repeated three times in total, every three weeks. Antibody response was measured at different times, using 96 well plates coated with human Fc-EpCAM for capture, and HRP-conjugated anti-mouse Fc specific polyclonal antibody (Jackson Immunoresearch) for detection. It was quantified by ELISA using. The data presented in FIG. 10 show antibody titers recorded 14 days (FIG. 10A), 27 (FIG. 10B), 55 (FIG. 10C) and 69 (FIG. 10D) post injection.
[145] The results presented in FIG. 10 indicate that low titers of specific antibody-EpCAM antibodies were induced during the first month using both agents (FIGS. 10A and 10B). Higher titers were obtained at 55 days (FIG. 10C) and higher titers were obtained at 69 days (FIG. 10D). Although the titers were lower, similar results were obtained with DNA injection of EpCAM-Fc expression vectors. These data show that antigens expressed as fusion molecules comprising protein antigens and immunoglobulin Fc sites can induce an immune response when introduced by injection of naked DNA, and sustained antigen exposure results in a delayed response in most animals. Inducement.
[146] The cellular immune response was tested by culturing spleen cells from protein immunized mice or vaccinated DNA stimulated with different concentrations of Fc-EpCAM protein in vitro. The data presented in FIG. 11 (top panel) are in animals immunized with DNA vaccination and Fc-EpCAM protein (cross) using either CMV promoter-EpCAM-Fc (open circle) or CMV promoter-Fc-EpCAM (closed diamond) expression vector. Proliferative response to the antigen (measured by ³ H-thymidine incorporation). Animals immunized with proteins showed a greater response to antigen even at very low doses. Responses from animals vaccinated with DNA (also shown on different scales in the lower panel of FIG. 11) were dose dependent but were lower than mice injected with proteins. These responses are characteristic of CD4 + T cell responses limited by MHC type 2.
[147] To test for cytotoxic activity (which generally means T cell responses limited by MHC type 1), spleen cultures from mice immunized with DNA or protein were in the presence of about 10 U / ml of IL-2. Incubated for 5 days. Effector cells were cultured splenocytes and target cells were labeled, human EpCAM-expressing CR26 colorectal carcinoma cells (synergistic with Balb / c mice) or labeled parent cells (nontransfected CT26 cells). Effector cells and target cells were mixed at different ratios to determine the degree of immunity. 100% immunity was obtained by culturing labeled target cells in the presence of a washing agent and the amount of label released was measured.
[148] The results are shown in Figure 12, where Figure 12A shows the activity of splenocytes on CT26 expressing human EpCAM, while Figure 12B shows the activity of splenocytes on CT26 parental cells. In both figures, open diamond represents splenocytes isolated from mice immunized with DNA carrying EpCAM constructs, open squares represent splenocytes isolated from mice immunized with DNA carrying Fc-EpCAM fusion constructs, Open triangles represent splenocytes isolated from mice immunized with DNA carrying the EpCAM-Fc fusion protein and crosses represent splenocytes isolated from mice immunized with Fc-EpCAM fusion protein.
[149] 12 shows that although DNA vaccines induced a weak cytotoxic response to both target cells, significantly higher cytotoxicity was observed in mice immunized with protein. Both CT26 tumor blasts and CT26 tumor cells expressing EpCAM were killed in the assay. The cytotoxicity observed for CT26 parental cells may be because these cells are capable of expressing high levels of mouse EpCAM homologues which are about 81% identical to human proteins at the amino acid level. Nevertheless, Fc-EpCAM protein immunization induced a significant degree of cytotoxic activity against CT26 tumor cells expressing human EpCAM, which may explain the potent tumor-protective activity described in Example 6.
[150] Example 9
[151] Immunization with Fc-fusion Proteins Containing Sub-regions of Protein Cancer Antigens
[152] Although some total proteins may not be useful as antigens for immunotherapy, smaller subregion proteins may be more effective. For example, proteins may contain domains that are modified after transcription to make them less immunogenic, thereby reducing immune responsiveness to actual polypeptide components. Large proteins do not mediate antibody-dependent cytotoxicity (ADCC), a potentially important component of the anti-tumor immune response, and can induce antibodies that only react with the nonpolypeptide portion of the antigen. A good example of this is the human melanoma-specific chondroitin sulfate proteoglycan (MCSP), which is expressed in several forms of brain cancer and almost all melanoma. The antibody known as 9.2.27 (Bumol et al. (1982) PROC. NATL. ACAD. SCI. 79: 1245-1249) binds to this protein with high affinity but does not have any effector action, ADCC or complement mediated cytotoxicity ( CDC). This antibody, in its very partially humanized (chimeric) form, does not mediate this activity.
[153] In order to elicit a more concentrated response to this larger molecule's more optimal target site, a protein glycan attachment site was identified (Pluske et al (1996) PROC. NATL. ACAD. SCI. USA 93). : 9710-9715). Sub-regions were selected that were not separated from the cell surface membrane spanning sequence, but at a distance from the glycan attachment site.
[154] Peptide sequence:
[155] QGATLRLDPTVLDAGELANRTGSVPRFRLLEGRHGRVVRVPRARTEPGGSQLVEQFTQQDLEDGRLGLEVGRPEGRAPGPAGD (SEQ ID NO: 21) was reverse transcribed and the resulting DNA sequence was chemically synthesized and linked into the pdCs-Fc-X expression vector using the same restriction sites as used in the above examples. The transcription termination site was added immediately following the sequence encoding the final amino acid, at the 3 'end, and the specific Xho I site was added. The final expression plasmid was electrophoresed into NS / 0 myeloma cells to obtain stable transformants expressing the protein of interest as described in Example 1.
[156] Fc-MCSP protein was purified from the culture supernatant using Protein A Sepharose Chromatography (Repligen, Needleham, Mass.). Antibody titers were measured in Balb / c mice immunized subcutaneously with 50 μg Gc-MCSP fusion protein in PBS alone or with 5 μg Fc-GMCSF as adjuvant. This result is shown in FIG. Black diamonds show antibody titers in normal serum, open squares show antibody titers in serum of mice immunized with Fc-MCSP, black triangles serum of mice immunized with Fc-MCSP and Fc-GMCSF adjuvant Antibody titers are shown.
[157] Specific immune responses to these MCSP subregions were detected at day 14 and significantly increased after further immunization. This result indicates that mice immunized with both Fc-GMCSF and Fc-MCSP stimulated higher antibody titers against MCSP (black triangle) compared to mice immunized with Fc-MCSP alone.
[158] Example 10
[159] Immunization with Fc-fusion Proteins Containing Viral Antigens
[160] The development of an effective vaccine against human immunodeficiency virus (HIV) that causes AIDS is one of the most important purposes of vaccine research. Recently, several reports have shown that certain properties of the viral envelope serve to conceal important and potential neutralizing sites of viral particles by causing the immune response to respond to inappropriate epitopes. These include the presence of highly immunodominant antigens acting as decoy, extensive glycosylation that physically conceals and reduces the immunogenicity of important epitopes (Wyagtt et al. (1998) NATURE 393: 705 -11).
[161] One possibility to circumvent the decoy mechanism is to express small regions of viral envelope genes to avoid unprotected immunodominant responses or to induce neutralizing responses. One problem with small subunit vaccines is reduced immunogenicity as synthetic peptides or small proteins. One approach has been to combine proteins or peptides with immunogenic carrier proteins such as keyhole limpet hemocyanin (KLH). This causes a strong response to KLH due to the protein or peptide. Another approach is to prepare fusion proteins using Fc as described in Example 1 for the sub-region of the ectodomain gp41 (immobilization domain of the viral envelope, gp160). Unlike other carriers, the immunoglobulin region has been shown to be “self”, thereby minimizing any immunodominant effects.
[162] The Fc-gp41pep626 fusion construct contained 44 amino acid polypeptides fused to the carboxyl terminus of the mouse immunoglobulin Fc region. The HIV strain IIIB sequence at this site contains a signal for N-linked glycosylation, so that the Fc-gp41pep626 fusion protein produced in NS / 0 myeloma cells by stable transfection or in 293 cells by transient expression is SDS-PAGE analysis showed a high degree of motility change, indicating heterogeneity in the glycosylation region.
[163] Despite the fact that these viral antigens were very small (44 amino acid residues in length) and heterologously glycosylated, it was possible to induce an immune response in Balb / c mice (see FIG. 14). In this case, 25 μg Fc-gp41pep626 alone (opened diamond), or Fc-adjuvant fusion protein, Fc-GMCSF (opened rectangle) or Fc-IL2 (black triangle) in 5 groups of mice on Day 1 ) Was injected intradermally with 2.5 μg, and two more injections, two weeks apart. 14A and 14B show antibody titers obtained at 7 and 33 days after the second additional immunization, respectively.
[164] This immune response was more dependent on the co-administration of Fc-cytokines and took longer to reach high titers. It is conceivable that a high immune response can be induced by modification of this sequence that does not contain a glycosylation signal (in fact, many strains do not encode this site) or by enzymatic removal of carbohydrates in vitro. .
[165] Example 11
[166] Adjuvant Activity of Fc-fusion Proteins Containing the Extracellular Domain of Cell Surface Molecules
[167] In order to construct an Fc-adjuvant fusion protein, it is sometimes useful to fuse to the Fc extracellular domain of a protein that can bind to the membrane. For example, the CD40 ligand (CD40L) is fused at the N terminus of the C terminus of Fc. Linkers are optionally used.
[168] CD40L is useful because its receptor, CD40, is expressed on the surface of B cells and is involved in the stimulation of B cells by T cells. Similar tumor necrosis factor, CD40L, is a trimer that induces trimerization or dimerization of its receptor on the cell surface. As a result, intracellular receptor domains come into contact and signal conversion occurs. In addition, like TNF, CD40L may be bound to the membrane, but may divide from the cell surface, and may act as a cytokine.
[169] The Fc-CD40L fusion protein is administered to the animal along with the Fc-antigen fusion protein. In a control experiment, Fc-CD40L protein and Fc-antigen protein are administered to different sets of animals. Animals injected with the fusion protein produce higher titers of antibodies than animals injected with each fusion protein individually.
[170] As an alternative, a single Fc-fusion protein containing the antigen and CD40L moiety is used with an optional linker (L) between the Fc, CD40L, and antigenic moiety. The fusion protein is N-terminus to C-terminus Fc- (L) -antigen- (L) -CD40L, Fc- (L) -CD40L- (L) -antigen, antigen) L) -CD40L- (L) -Fc, CD40L- (L) -antigen- (L) -Fc, antigen- (L) -Fc- (L) -CD40L, or CD40L-Fc- (L) -antigen- (L). Fusion proteins containing Fc, antigen, and CD40L are injected into the animal and antibody titers are measured. It can be seen that the antibody titer obtained by injection of a fusion protein containing both CD40L and antigen is higher than the titer obtained by injection of Fc and antigen or fusion protein containing only Fc and CD40L.
[171] In the foregoing administration of the aforementioned fusion protein, the animal is injected intravenously, subcutaneously, or by any other suitable method of administration. Determination of time and antibody titer between first and further administrations of antigen and / or adjuvant is as described in the Examples above. Alternatively, standard doses and assays are used.
[172] Equivalent
[173] The invention can be illustrated in other specific forms without departing from the scope of the invention. Accordingly, the foregoing embodiments should be construed as illustrative without limiting the invention described herein. Therefore, the scope of the present invention is not limited by the above detailed description of the invention, but is defined by the claims, and all modifications within the scope of the claims and the identicality should be included in the scope of the present invention.
[174] references
[175] The teachings of all patent documents and scientific publications cited herein above are hereby incorporated by reference.

权利要求:
Claims (45)
[1" claim-type="Currently amended] A method of enhancing the immunogenicity of a preselected antigen in a mammal,
Inducing an immune response to a preselected antigen by administering a fusion protein comprising an immunoglobulin heavy chain constant region bound to a preselected antigen by intracellular, intravenous, intradermal or subcutaneous polypeptide binding to the mammal. The preselected antigen in the fusion protein induces a stronger immune response in the mammal than the preselected antigen alone
How to include.
[2" claim-type="Currently amended] The method of claim 1, wherein the fusion protein is administered with an adjuvant in an amount sufficient to enhance the immune response of the fusion protein to the preselected antigen compared to the immune response of the fusion protein administered without the adjuvant. The method further comprises a step.
[3" claim-type="Currently amended] The method of claim 2, wherein the fusion protein and adjuvant are administered simultaneously.
[4" claim-type="Currently amended] The method of claim 2, wherein the adjuvant comprises a fusion protein containing an immunoglobulin heavy chain constant region bound to the adjuvant protein by polypeptide binding.
[5" claim-type="Currently amended] The method of claim 1 or 4, wherein the immunoglobulin heavy chain constant portion comprises an immunoglobulin hinge portion.
[6" claim-type="Currently amended] The method of claim 5, wherein the immunoglobulin heavy chain constant portion comprises an immunoglobulin heavy chain constant region domain selected from the group consisting of CH2 domain, CH3 domain, and CH4 domain.
[7" claim-type="Currently amended] The method of claim 5, wherein the immunoglobulin heavy chain constant portion comprises a CH2 domain and a CH3 domain.
[8" claim-type="Currently amended] 5. The method of claim 1 or 4, wherein said immunoglobulin heavy chain constant portion is defined by an amino acid sequence corresponding to an amino acid sequence defining an immunoglobulin heavy chain constant region present in the same species as said mammal.
[9" claim-type="Currently amended] The method of claim 8, wherein the amino acid sequence defining the immunoglobulin heavy chain constant region corresponds to a human immunoglobulin heavy chain constant region.
[10" claim-type="Currently amended] The method of claim 1, wherein the preselected antigen is selected from the group consisting of prostate-specific membrane antigens, ectodomains of cytokine receptors, viral proteins and tumor-specific proteins.
[11" claim-type="Currently amended] The method of claim 4, wherein the adjuvant protein is a cytokine.
[12" claim-type="Currently amended] The method of claim 11, wherein the cytokine is defined by an amino acid sequence corresponding to an amino acid sequence that defines a cytokine present in the same species as the mammal.
[13" claim-type="Currently amended] The method of claim 12, wherein the cytokine is a human cytokine.
[14" claim-type="Currently amended] The method of claim 1, wherein the mammal is a human.
[15" claim-type="Currently amended] A composition inducing an immune response to a preselected antigen in a mammal, the composition comprising a mixture for intramuscular, intravenous, transdermal or subcutaneous administration selected from the group consisting of (a) and (b):
(a) an antigen fusion protein comprising an immunoglobulin heavy chain constant region bound to a preselected antigen mixed with an adjuvant by polypeptide binding
(b) a preselected antigen mixed with an adjuvant fusion protein comprising an immunoglobulin heavy chain constant region bound to the adjuvant protein by polypeptide binding.
[16" claim-type="Currently amended] The composition of claim 15, wherein the adjuvant of (a) comprises a fusion protein containing an immunoglobulin constant region bound to an adjuvant protein by polypeptide binding.
[17" claim-type="Currently amended] The composition of claim 15, wherein the preselected antigen of (b) is bound to an immunoglobulin heavy chain constant region by polypeptide binding.
[18" claim-type="Currently amended] 18. The composition of any one of claims 15 to 17, wherein the immunoglobulin heavy chain constant portion comprises an immunoglobulin hinge portion.
[19" claim-type="Currently amended] The composition of claim 18, wherein the immunoglobulin heavy chain constant portion comprises an immunoglobulin heavy chain constant region domain selected from the group consisting of a CH2 domain, a CH3 domain, and a CH4 domain.
[20" claim-type="Currently amended] The composition of claim 18, wherein the immunoglobulin heavy chain constant portion comprises a CH2 domain and a CH3 domain.
[21" claim-type="Currently amended] The composition of claim 15, wherein the adjuvant of (a) comprises an oligonucleotide CpG sequence.
[22" claim-type="Currently amended] The composition of claim 15, wherein the preselected antigen is selected from the group consisting of prostate-specific membrane antigens, ectodomains of cytokine receptors, viral proteins and tumor-specific proteins.
[23" claim-type="Currently amended] The composition of claim 15, wherein the antigen fusion protein of (a) or the adjuvant fusion protein of (b) is bound to a second immunoglobulin heavy chain constant region by disulfide binding.
[24" claim-type="Currently amended] The composition of claim 15 wherein the adjuvant of (a) or the adjuvant protein of (b) is a cytokine.
[25" claim-type="Currently amended] The composition of claim 24, wherein said cytokine is a human cytokine.
[26" claim-type="Currently amended] 18. The composition of any one of claims 15 to 17, wherein the immunoglobulin heavy chain constant portion is defined by an amino acid sequence corresponding to an amino acid sequence defining a human immunoglobulin heavy chain constant portion.
[27" claim-type="Currently amended] A method of enhancing the immunogenicity of a preselected antigen in a mammal,
Administering to a mammal a nucleic acid sequence encoding a fusion protein comprising an immunoglobulin heavy chain constant region bound to a preselected antigen, wherein the nucleic acid sequence is expressed in the mammal to produce a fusion protein, the preselected antigen of the protein Inducing a stronger immune response compared to a preselected antigen expressed from a nucleic acid encoding only the preselected antigen.
How to include.
[28" claim-type="Currently amended] The method of claim 27, wherein the nucleic acid encodes an immunoglobulin heavy chain constant region and a preselected antigen in the 5 ′ to 3 ′ direction.
[29" claim-type="Currently amended] The method of claim 28, wherein the immunoglobulin heavy chain constant portion comprises an immunoglobulin hinge portion.
[30" claim-type="Currently amended] 30. The method of claim 27 or 29, wherein the immunoglobulin heavy chain constant portion comprises a heavy chain domain selected from the group consisting of a CH2 domain, a CH3 domain and a CH4 domain.
[31" claim-type="Currently amended] The method of claim 29, wherein the immunoglobulin heavy chain constant portion comprises a CH2 domain and a CH3 domain.
[32" claim-type="Currently amended] The method of claim 27, wherein the preselected antigen is selected from the group consisting of prostate-specific membrane antigens, ectodomains of cytokine receptors, viral proteins and tumor-specific antigens.
[33" claim-type="Currently amended] The method of claim 27, further comprising administering said nucleic acid sequence with an adjuvant.
[34" claim-type="Currently amended] The method of claim 33, wherein the adjuvant comprises a nucleic acid sequence encoding a fusion protein comprising an immunoglobulin heavy chain constant region bound to an adjuvant protein.
[35" claim-type="Currently amended] (a) a first nucleic acid sequence encoding a fusion protein comprising an immunoglobulin heavy chain constant region and a preselected antigen, wherein said nucleic acid sequence is expressed in a mammal to produce a fusion protein, wherein the preselected antigen of the protein is preselected A first nucleic acid sequence that induces a stronger immune response compared to a preselected antigen expressed from a nucleic acid encoding only an antigen; And
(b) adjuvant
Including, a composition for inducing an immune response against a preselected antigen in a mammal.
[36" claim-type="Currently amended] 36. The composition of claim 35, wherein said adjuvant comprises a second nucleic acid sequence encoding a fusion protein comprising an immunoglobulin heavy chain constant region bound to an adjuvant protein by peptide bonds.
[37" claim-type="Currently amended] 37. The composition of claim 35 or 36, wherein the immunoglobulin heavy chain constant portion comprises an immunoglobulin hinge portion.
[38" claim-type="Currently amended] 37. The composition of claim 35 or 36, wherein the immunoglobulin heavy chain constant portion comprises an immunoglobulin heavy chain domain selected from the group consisting of CH2 domains, CH3 domains and CH4 domains.
[39" claim-type="Currently amended] The composition of claim 37, wherein the immunoglobulin heavy chain constant portion comprises an immunoglobulin heavy chain domain selected from the group consisting of a CH2 domain, a CH3 domain, and a CH4 domain.
[40" claim-type="Currently amended] 36. The composition of claim 35, wherein said preselected antigen is selected from the group consisting of prostate-specific membrane antigens, ectodomains of cytokine receptors, viral proteins and tumor-specific antigens.
[41" claim-type="Currently amended] 37. The composition of claim 36, wherein said adjuvant protein is a cytokine.
[42" claim-type="Currently amended] 36. The composition of claim 35, wherein said first nucleic acid sequence is operably placed in a replicable expression vector.
[43" claim-type="Currently amended] The composition of claim 36, wherein the second nucleic acid sequence is operably placed in a replicable expression vector.
[44" claim-type="Currently amended] A method of enhancing the immunogenicity of a preselected antigen in a mammal,
Simultaneously or sequentially administering to the mammal a first fusion protein comprising an antigenic protein having a localizing protein and a second fusion protein containing the ubiquitous protein and an adjuvant protein, wherein the ubiquitous protein is administered to the immune system. Increasing the concentration of the first and second fusion proteins in an accessible mammalian region
How to include.
[45" claim-type="Currently amended] A method of enhancing the immunogenicity of a preselected antigen in a mammal,
Administering to the mammal a fusion protein comprising an antigenic protein, an adjuvant protein and a localized protein, wherein the localized protein increases the concentration of the antigen and adjuvant in a region of the mammal that is easily accessible to the immune system.
How to include.

类似技术:

---

公开号 | 公开日 | 专利标题

---

US20190062445A1|2019-02-28|Fully human antibodies against human 4-1bb

---

JP5918817B2|2016-05-18|Compositions and methods for immunomodulation in organisms

---

US20180086810A1|2018-03-29|T cell receptor fusions and conjugates and methods of use thereof

---

DE69534946T2|2006-12-28|Use of naked polynucleotides for the manufacture of a medicament for the treatment of tumors

---

AU715067B2|2000-01-13|A polynucleotide tuberculosis vaccine

---

EP1078092B1|2011-08-03|Expression vectors for stimulating an immune response and methods of using the same

---

AU692152B2|1998-06-04|Immunogenic chimeras comprising nucleic acid sequences encoding endoplasmic reticulum signal sequence peptides and at least one other peptide, and their uses in vaccines and disease treatments

---

CA2468259C|2015-11-24|Antibody to latent membrane proteins and uses thereof

---

US6312700B1|2001-11-06|Method for enhancing an antigen specific immune response with OX-40L

---

JP3195958B2|2001-08-06|Pharmaceutical composition for treating or preventing malignant tumor

---

US6168923B1|2001-01-02|Compositions and methods for use of IL-12 as an adjuvant

---

DE69636891T2|2007-12-06|Immunostimulating composition and method

---

US8791237B2|2014-07-29|Compositions and methods for treatment of non-hodgkins lymphoma

---

JP3581366B2|2004-10-27|Lysosomal targeting of immunogens

---

EP1673460B1|2012-12-12|Recombinant vaccines and use thereof

---

US7745215B2|2010-06-29|Methods and compositions for expanding T regulatory cells

---

Liu et al.1998|Immunostimulatory CpG oligodeoxynucleotides enhance the immune response to vaccine strategies involving granulocyte-macrophage colony-stimulating factor

---

DE69534880T2|2007-02-22|Mhc complexes and uses thereof

---

Gurunathan et al.1998|CD40 ligand/trimer DNA enhances both humoral and cellular immune responses and induces protective immunity to infectious and tumor challenge

---

JP4601956B2|2010-12-22|HIV-GAG codon optimized DNA vaccine

---

JP3919220B2|2007-05-23|Bioactive fusion proteins and treatment of preexisting tumors

---

JP4662708B2|2011-03-30|Methods and compositions for targeting proteins to exosomes

---

US6232445B1|2001-05-15|Soluble MHC complexes and methods of use thereof

---

Fallarino et al.2000|Th1 and Th2 cell clones to a poorly immunogenic tumor antigen initiate CD8+ T cell-dependent tumor eradication in vivo

---

AU2002233560B2|2006-09-07|Vaccine

同族专利:

---

公开号 | 公开日

---

US20100068175A1|2010-03-18|

---

RU2248214C2|2005-03-20|

---

CN1308037C|2007-04-04|

---

SK782002A3|2003-08-05|

---

CA2378866A1|2001-02-01|

---

PT1198250E|2008-01-02|

---

HU0202796A2|2002-12-28|

---

AU779388B2|2005-01-20|

---

WO2001007081A1|2001-02-01|

---

PL201664B1|2009-04-30|

---

EP1198250B1|2007-09-26|

---

JP4764585B2|2011-09-07|

---

CN1374871A|2002-10-16|

---

DE60036552T2|2008-06-26|

---

EP1198250B8|2007-11-21|

---

US20050261229A1|2005-11-24|

---

JP2003505431A|2003-02-12|

---

AT374042T|2007-10-15|

---

ES2292457T3|2008-03-16|

---

ZA200200501B|2003-03-26|

---

EP1198250A1|2002-04-24|

---

AU6358300A|2001-02-13|

---

CA2378866C|2011-06-07|

---

NO20020255L|2002-03-15|

---

NO20020255D0|2002-01-17|

---

US8043608B2|2011-10-25|

---

CZ304884B6|2015-01-07|

---

CZ2002182A3|2003-11-12|

---

US7955590B2|2011-06-07|

---

DK1198250T3|2007-12-27|

---

KR100689739B1|2007-03-09|

---

DE60036552D1|2007-11-08|

---

MXPA02000746A|2002-09-18|

---

PL353344A1|2003-11-17|

---

BR0012569A|2002-05-28|

引用文献:

---

公开号 | 申请日 | 公开日 | 申请人 | 专利标题

---

法律状态:
1999-07-21|Priority to US14496599P

---

1999-07-21|Priority to US60/144,965

---

2000-07-21|Application filed by 추후보정, 렉시겐 파마슈티칼스, 코프.

---

2002-03-15|Publication of KR20020020794A

---

2007-03-09|Application granted

---

2007-03-09|Publication of KR100689739B1

优先权:

---

申请号 | 申请日 | 专利标题

---

US14496599P| true| 1999-07-21|1999-07-21|

---

US60/144,965|1999-07-21|